KEGG   Enterococcus faecalis D32: EFD32_1545Help
Entry
EFD32_1545        CDS       T02172                                 

Definition
(GenBank) lactamase_B super family protein
  KO
K06167  phosphoribosyl 1,2-cyclic phosphate phosphodiesterase [EC:3.1.4.55]
Organism
efd  Enterococcus faecalis D32
Pathway
efd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    EFD32_1545
Enzymes [BR:efd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.55  phosphoribosyl 1,2-cyclic phosphate phosphodiesterase
     EFD32_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: AFO44431
LinkDB All DBs
Position
1612338..1613168
Genome map
AA seq 276 aa AA seqDB search
MKINYLGTGAAERIPGIFCNCKLCKYAREKKGREIRTQTQLIIDDILLIDFPGDSYLHLL
QYDLCFADFNSLLISHWHSDHFYGEDLAYRMSGYALDIPNRLTVYGNEAVKTFYQRAFDL
EGRQDDTRLHYQVIQPYKCFTIANYTIYPLPAQHGNFSEDCFIFVIDDGKDAFLSTHDTG
YFTSEMFEYLEKSHLLLSIVSLDCTSQTNETGNSHMNWEENLKLIAELKERKLVTDKTIY
VANHFSHNGGLSYAEMAALSQKHEIITSYDGLEILT
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaactatttaggtacgggtgcagcagaacggattccaggaattttttgtaat
tgtaaattatgtaaatacgctcgagagaaaaaaggacgagaaattcgtacacaaactcaa
ttaattattgatgatatcctgctgattgattttccaggggattcttatttacacttgttg
cagtatgacttgtgttttgcagactttaactctttactaatctctcattggcattccgat
catttttacggcgaggatttggcttatcgaatgtctggttatgcattagatattcccaat
cgtttaactgtttacggaaatgaagcagttaagacgttttatcagcgcgcctttgattta
gaaggtcgtcaagacgatacccgattacattatcaggttattcagccctacaaatgtttt
actattgcgaactatacgatttatccccttcctgcacaacatggaaatttcagtgaagat
tgttttattttcgttatagacgatggtaaagatgcttttttatccacccatgatacaggt
tactttacgtcagaaatgtttgaatatcttgaaaagagccacttacttcttagtattgtt
tctttagattgtactagtcaaacaaacgaaactggcaatagtcatatgaattgggaagaa
aatttaaaattaattgcagaattaaaagaaagaaaactcgtcacagataaaacgatttac
gttgccaaccatttttctcacaatggcggcttgtcttatgcggagatggcggctttatct
caaaagcatgaaatcattacgagttatgatggtttagaaatactaacttaa

DBGET integrated database retrieval system