KEGG   Enterococcus faecalis D32: EFD32_1921Help
Entry
EFD32_1921        CDS       T02172                                 

Definition
(GenBank) ABC superfamily ATP binding cassette transporter, membrane protein
  KO
K02004  putative ABC transport system permease protein
Organism
efd  Enterococcus faecalis D32
Brite
KEGG Orthology (KO) [BR:efd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:efd02000]
    EFD32_1921
Transporters [BR:efd02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter
    EFD32_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX DctQ
Motif
Other DBs
NCBI-ProteinID: AFO44805
LinkDB All DBs
Position
complement(1984828..1986330)
Genome map
AA seq 500 aa AA seqDB search
MNYIKRAIQSLWAKKGRSIIMITVFSAILIFVLAGLTIHSGAELATTNAKKSVGATVTLS
TNREAMFKQQSNSDSDAESSRPDPGSFEPTSVNLSDAKKIAELANVKSYSFEASTSADKG
TGITPISSDSDSEEESSDEQTVGFGGQKAPDGMSQGDFQIKGVSESNSYSDFSIGTANLV
EGKAITSDDEGTNNVLIEQSLAEANNLSVGDKFKIKDIDDKDIEVTIKGIYKTSDSSNSM
SARFNFMNSANTIFSSYTLVNTLTGSEGKTIDSAVYNLDDPKDMDSFVEAANKLIDTDTF
SLETNDQMYQQMLQPLNNVASFAKNVVILVAVAGVIILTLIIMLSIRERKYEIGVLLSLG
EPRVKVILQFFVEIFVCMIFALGIAAASGNVVGNAVGNQLLSQQTTSQSPDGQEANTAGN
RGPNQDNQGQAPDGGNGGPKGGQIGINPFTQSKEIKELNISMQPTEILSLAGIGLGISLF
SIVLSSAGILRLNPKKILIS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaactatatcaaacgggcgattcaaagcctttgggcaaaaaaaggacgcagtatcatt
atgatcaccgtcttttccgccatattaatttttgtattagcggggttaacgattcacagc
ggagctgaattggcaaccacgaatgcgaaaaaaagtgtcggggcgaccgtcaccttatca
acgaaccgagaggcaatgttcaaacagcaatcgaattcagattcagatgccgaaagtagt
cgtccagatccaggtagttttgaacctacatccgtcaacttgagtgatgcgaaaaaaatc
gcagaattagcgaatgttaaatcatattcatttgaagcaagtacttcagcggataaaggc
accgggattacaccgatctcgagtgatagtgacagtgaagaggaatcttcggatgaacaa
actgttggatttggtggacagaaagcccccgatgggatgagtcaaggggattttcaaatt
aaaggtgtttccgaaagtaattcttacagtgatttttcgataggaacagctaacctagtt
gaaggcaaggcaatcacttcggatgatgaagggactaataatgtactgattgagcaaagt
ttagcggaagcaaacaatctaagtgtcggggataaatttaagattaaagatatcgatgat
aaagatattgaagttactattaaaggtatttacaaaacaagtgattccagcaacagtatg
agtgctcgcttcaactttatgaattcagcgaatacgattttttcttcttatacactggtt
aacaccttaactggatcggaaggaaaaacgatcgattcggcagtgtataacttagatgat
cccaaagacatggacagctttgtagaagcagcgaataaattgatcgatacggatacattt
agtttagaaaccaatgatcaaatgtatcagcaaatgcttcaaccattgaataatgtagca
agctttgcgaagaatgtcgtgattttagtagctgtagccggagttattattttaaccttg
attattatgctgtcgattcgtgaacgtaaatatgagattggtgtattactttcattaggt
gaaccacgagtcaaagttattttacaatttttcgttgagatttttgtttgcatgatcttc
gctttaggaattgctgcagctagcggaaatgttgttggcaacgcagtcggcaatcagttg
ttgagtcagcaaacaacttcgcaaagtccagatggacaagaagcgaatacggcaggaaat
agaggtccaaatcaagataaccaaggacaagcacctgatggcggaaacggtggtcctaaa
ggtggtcaaattggaatcaatccatttacacaatcaaaagaaatcaaagaactaaatatc
tcaatgcaaccaaccgaaattttaagtcttgcaggaattgggctggggattagtttattt
tcaattgtcctttcatcagcaggaattctacgactgaatccgaagaaaatattgatttcc
taa

DBGET integrated database retrieval system