KEGG   Enterococcus faecalis D32: EFD32_2558Help
Entry
EFD32_2558        CDS       T02172                                 

Definition
(GenBank) PTS system sorbose-specific iic component family protein
  KO
K17466  D-glucosaminate PTS system EIIC component
Organism
efd  Enterococcus faecalis D32
Pathway
efd00030  Pentose phosphate pathway
efd01120  Microbial metabolism in diverse environments
efd02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:efd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EFD32_2558
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    EFD32_2558
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:efd02000]
    EFD32_2558
Transporters [BR:efd02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   D-Glucosaminate-specific II component
    EFD32_2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EII-Sor
Motif
Other DBs
NCBI-ProteinID: AFO45440
LinkDB All DBs
Position
complement(2610945..2611694)
Genome map
AA seq 249 aa AA seqDB search
MGVLGVSIIMGLYYWFARLRFGYTFSGMLSQPLGAALVAGLATGKLSEAMVVGAGIQLVY
LGVTSTPGGNVPSDPALASAIAIPIALGVGMNAEAAVALAVPFGVLGVFMDQLRRTINAT
WVHMADKYAEELNYGGIYRAAFVYPALAGFLIRFPLVFAANFFGQSVVNKVLEVIPAWLM
HGFEVMGGILPALGFALTIMVIGKKNLIPYFLIGFVAVVYFGAEVMAVAILGICIAFLVR
NKALSEEAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttttaggtgtttcaattattatgggactttattattggtttgcacgtttgcgt
tttgggtacacattttcaggcatgctgtctcagccattaggcgcagcgttggtggctggt
ttagcaacaggaaaacttagtgaagcaatggttgtgggggcggggattcaacttgtttat
ctaggagtcacctccacaccgggcggcaatgtgcctagtgatccggctttagcttcagca
atcgcgattccgattgctttaggtgtgggaatgaatgccgaggcggctgttgcactagct
gttccttttggtgtgttaggcgtctttatggatcaattacggcggaccatcaatgcgact
tgggtgcatatggctgataaatatgcagaagagttaaattatggggggatttaccgagct
gcgtttgtttatccagctttagcgggatttttaattcgctttcctttggtttttgcggcg
aacttttttggtcaatccgtggtgaataaagtcttagaagttatcccagcatggttgatg
cacggctttgaagtaatgggtggtattttaccagcgttaggcttcgccttaacaattatg
gtaattggcaagaaaaatttgattccttattttttaattggttttgttgcagtagtatat
tttggcgcagaagttatggccgtcgctattttaggaatctgtattgcctttttagttaga
aacaaggcattgagtgaggaggcagcataa

DBGET integrated database retrieval system