KEGG   Escherichia fergusonii: EFER_0114Help
Entry
EFER_0114         CDS       T00811                                 

Gene name
ddlB
Definition
(GenBank) D-alanine:D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
efe  Escherichia fergusonii
Pathway
efe00473  D-Alanine metabolism
efe00550  Peptidoglycan biosynthesis
efe01100  Metabolic pathways
efe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:efe00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    EFER_0114 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EFER_0114 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    EFER_0114 (ddlB)
Enzymes [BR:efe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EFER_0114 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:efe01011]
 Precursor biosynthesis
  Amino acid ligase
   EFER_0114 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp ATP-grasp_3 ATPgrasp_YheCD ATPgrasp_ST TTL GARS_A Luciferase_N
Motif
Other DBs
NCBI-ProteinID: CAQ87697
UniProt: B7LWF8
LinkDB All DBs
Position
124202..125122
Genome map
AA seq 306 aa AA seqDB search
MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGVDAYPVDPKDVDVAQLKSMGFQKVFI
ALHGRGGEDGTLQGMLELLGLPYTGSGVMASAISMDKLRSKLLWQGAGLPVAPWVAITRT
EFEKGLSDEVVKQISALGLPLIVKPSREGSSVGMSKVVAENSVENALKLAFQHDDEVLVE
KWLSGPEFTVAILGEEILPSIRIQPAGTFYDYEAKYLSDETQYFCPSGLEAEQESILKSL
VQKAWTTLGCKGWGRIDVMLDDDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactgataaaattgctgttctgctgggtggcacttccgcagagcgggaagtttcactg
aattcaggtgcggctgtgttggcgggtctgcgtgaaggcggtgtagatgcatatcctgtc
gacccgaaagacgtcgatgtggcacagctgaaatccatgggatttcaaaaggtgtttatt
gccctgcatggccgtggcggtgaggacggtaccctacaaggtatgcttgagcttctgggc
ttaccttataccggtagtggtgtgatggcttcagctatttcaatggacaagctgcgtagc
aaattattatggcaaggggcagggctgcccgttgctccatgggtggcaatcacgcgtact
gagtttgaaaaagggcttagtgatgaagtggttaaacaaatttctgcgttaggtttacca
ttaatagtgaaaccaagccgcgaaggctcaagcgttggaatgtcgaaagtagtagcagaa
aattctgttgaaaatgcattaaaattggcatttcagcatgatgacgaagttctggttgaa
aaatggctaagtgggccggagttcacggttgcgatactcggagaagaaattttaccatcg
attcgtatccaacctgctggaaccttctatgattatgaggcgaaatatctctctgatgag
acacaatatttctgtccatctggtctggaagcagaacaagagtcgattttaaagtcgtta
gtgcaaaaagcatggacaactttaggctgcaaaggatggggacgcattgacgtcatgttg
gatgatgatgggcagttttatctgctggaagcgaatacctcgccggggatgaccagccat
agtctggtgccaatggctgcgcgtcaggcaggaatgagtttttcgcagttggtagtacga
attctggaattggcggactga

DBGET integrated database retrieval system