KEGG   Escherichia fergusonii: EFER_1575Help
Entry
EFER_1575         CDS       T00811                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase B, PLP-dependent
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
efe  Escherichia fergusonii
Pathway
efe00250  Alanine, aspartate and glutamate metabolism
efe00410  beta-Alanine metabolism
efe00430  Taurine and hypotaurine metabolism
efe00650  Butanoate metabolism
efe01100  Metabolic pathways
efe01110  Biosynthesis of secondary metabolites
efe01120  Microbial metabolism in diverse environments
efe02024  Quorum sensing
Module
efe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:efe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EFER_1575 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EFER_1575 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EFER_1575 (gadB)
   00430 Taurine and hypotaurine metabolism
    EFER_1575 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EFER_1575 (gadB)
Enzymes [BR:efe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     EFER_1575 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAQ89093
UniProt: B7LRF1
LinkDB All DBs
Position
1613670..1615070
Genome map
AA seq 466 aa AA seqDB search
MDKKQVTDFRSELLDSRFGAKAISTVAESKHFPLHEMRDDIAFQIISDELFLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPTPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTNKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPQRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISSSGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDVVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaagcaagtaacggattttcgctctgaactactcgattcacgttttggcgct
aaagccatttctaccgtagcggaatcaaaacattttccgcttcatgaaatgcgtgatgat
atcgcgttccagattatcagcgatgaattatttctcgatggtaacgcccgtcagaacctg
gcaactttctgccagacctgggatgacgaaaatgtccataaactgatggatttatcgatc
aataaaaactggatcgataaagaagagtatccgcaatcagccgctatcgacctgcgctgc
gtaaatatggttgcagatctatggcatgcgccgactccgaaaaacggccaggccgtaggc
accaacaccatcggctcctctgaagcctgtatgttgggcgggatggcgatgaaatggcgc
tggcgcaaacgtatggaagctgctggcaaaccaacgaacaaacccaacctggtttgtggc
ccggtacaaatctgctggcataaatttgcccgttactgggatgtagagttgcgtgagatc
cctatgcgtccgggacagttattcatggatccgcagcgcatgattgaagcctgcgacgaa
aacaccatcggcgtagtgccgaccttcggtgtgacctataccggtaactatgaattccca
caaccgctgcacgatgcactggataaattccaggcggataccggtattgatatcgatatg
catatcgatgccgccagtggtggtttcctcgcaccgtttgttgccccggatattgtctgg
gatttccgtctgccacgtgtgaaatctatcagcagttcgggtcacaaattcggccttgct
ccgttgggctgcggttgggttatctggcgtgacgaagaagctctgccgcaagagttggta
tttaacgtcgactacctgggggggcagatcggtactttcgccatcaacttctcccgcccg
gcaggtcaggttatcgctcaatactatgaattcctgcgtcttggtcgtgaaggctacacc
aaagtgcagaacgcctcttatcaggtagcggcataccttgcggatgaaatcgccaaactg
gggccgtatgagttcatctgtaccggtcgccctgacgaaggtatcccggctgtctgcttc
aaactgaaagatggggaagatccagggtataccctgtatgacctctctgaacgcctgaga
ctgcgcggctggcaggttcctgcctttaccctcggtggtgaagctaccgacgtagtagta
atgcgcattatgtgccgccgtggtttcgaaatggacttcgctgaactgctgctggaagac
tacaaagcctccctgaaatatctcagcgaccatccgaaattacagggtattgcacaacag
aacagctttaaacatacctga

DBGET integrated database retrieval system