KEGG   Escherichia fergusonii: EFER_2642Help
Entry
EFER_2642         CDS       T00811                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
efe  Escherichia fergusonii
Pathway
efe00473  D-Alanine metabolism
efe00550  Peptidoglycan biosynthesis
efe01100  Metabolic pathways
efe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:efe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EFER_2642 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EFER_2642 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    EFER_2642 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:efe01011]
    EFER_2642 (ddlA)
Enzymes [BR:efe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EFER_2642 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:efe01011]
 Precursor biosynthesis
  Amino acid ligase
   EFER_2642 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAQ90137
UniProt: B7LMK4
LinkDB All DBs
Position
2712312..2713406
Genome map
AA seq 364 aa AA seqDB search
MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKQGQWHVSDAANYLLN
ADDPARIALRPSATSLAQVPGKHEQQLIDAQTAQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFVTLTRANRSTITFAEIEAQLGL
PLFVKPANQGSSVGVSKVTNEAEYKKAVDLAFEYDHKVVVEKGIKGREIECAVLGNDHPQ
ASTCGEIVLNSDFYAYDTKYIDDDGAKVVVPAAIPAEINDKIREIAVKAYQTLGCAGMAR
VDVFLTLENDVVINEINTLPGFTNISMYPKLWQASGLSYTDLITRLIELALERHAANNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattgcgagttggaatcgtatttggcggaaaatcagcggaacacgaagtgtca
ttgcaatcggcaaaaaatattgtcgatgccatcgacaaaacccgctttgacgtcgtgctg
ttaggtattgataagcaagggcaatggcacgtcagtgatgcggcaaactatttattgaac
gcagacgatccggcacggattgcgctgcgtccttcagccaccagcctggcacaggttccg
ggcaaacatgagcagcaattgatcgatgcgcaaactgcgcagccgctgccgacggtcgac
gtgatcttccctatcgttcatggcacgcttggtgaagacggttcattgcagggtatgttg
cgtgtggcaaatctgccatttgtcggttctgatgtgcttggttccgctgcctgcatggat
aaagatgtcactaaacgtttactacgcgatgccggacttaacatcgcgccgttcgtcacg
ctgactcgtgctaaccgcagtaccatcacctttgctgaaattgaagcacaactggggctt
ccgttatttgttaaaccggctaaccaggggtcttctgtcggtgtcagtaaagttaccaac
gaagccgaatataaaaaagccgtcgatttggcctttgaatacgatcataaagtggttgtt
gagaaaggtattaaaggacgtgaaatcgaatgtgccgtgttaggtaatgatcatccacaa
gccagtacctgtggcgaaattgttcttaacagcgatttctatgcctacgacaccaaatac
attgacgatgatggcgcgaaagttgttgttccggcggctatccccgctgaaattaacgat
aagatccgtgaaattgcagtaaaagcctatcagactcttggttgtgcaggtatggcacgc
gttgatgtctttttaacgctggaaaacgacgtggtgattaatgagatcaatacgttgcct
ggctttaccaacatcagcatgtatccgaaactgtggcaggcaagtggtttgagttatacc
gacctgattactcgcctgattgagttagcgctggagcgccacgcagcaaataacgcgctg
aaaacgacaatgtaa

DBGET integrated database retrieval system