KEGG   Escherichia fergusonii: EFER_3569Help
Entry
EFER_3569         CDS       T00811                                 

Gene name
malS
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
efe  Escherichia fergusonii
Pathway
efe00500  Starch and sucrose metabolism
efe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EFER_3569 (malS)
Enzymes [BR:efe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     EFER_3569 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: CAQ91041
UniProt: B7LTI2
LinkDB All DBs
Position
3652839..3654947
Genome map
AA seq 702 aa AA seqDB search
MITREEFYRTYHWQTGEIRSNKSSSIMKLAACFLLLLPGVAVAATWTSGGFPTFDEQSTG
KYASHAQLTKGTRALTLNFDQQCWQPADAIKLNQMLSLKPCDSTPPQWRLFRDGEYTLQV
DTRSGTPTLMISVTSTAQPTINLIRECPKWDGQPLTLDVSQTFPEGAAIREYYSQQIVTV
KNGHITLKPVTESNGLLLLEHAETHTSAPFDWHNATVYFVLTDRFENGDPGNDQSYGRHK
DGMQEIGTFHGGDLRGLTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHG
YYTQDWTNLDANIGSEAELRALVDGAHQRGIRIIFDVVMNHTGYATLADMQEFQFGALYL
SGDELKKTLGERWSDWKPAAGQTWHSFNDYINFSDKTGWEKWWGKNWIRTDIGDYDNPGF
DDLTMSLAFLPDIKTESTTASGLPVFYKNKPDTHAKAIDGYTPRDYLTHWLSQWVRDYGI
DGFRVDTAKHVELPAWQQLKTEASAALNEWKKANPEKALDDNSFWMTGEAWGHGVMQSDY
YRNGFDAMINFDYQEQAAKAVDCLAQMDNIWQQMAEKLQDFNVLSYLSSHDTRLFREGGK
KSAELLLLAPGAVQIFYGDESLRPFGPTGSDPLQGTRSDMNWQDVSDKSAASVKHWQRIS
QFRARHLAIGAGKQTTLSLPQGYGFVREHGDDKVMVIWAGQH
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgattaccagggaggagttttaccggacttatcactggcaaactggtgaaattcgcagc
aataagagctcatccattatgaaacttgccgcctgttttctgctacttctgcctggcgtt
gccgttgccgccacctggacttccgggggatttcccacctttgacgaacaaagtacaggt
aaatatgccagtcacgcgcagctgaccaaaggtacgcgcgcgttaacgttaaattttgac
caacagtgctggcaacctgcggatgccataaaactcaatcagatgctttccctgaaacct
tgtgacagcacgcctccccagtggcgattattccgcgatggcgagtacaccttacaagtt
gatacacgctctggcacgccaacgttgatgatttcggtgaccagcaccgcacaaccaaca
ataaatctgatacgtgaatgcccgaaatgggatgggcaaccgctcactctggatgtcagt
caaacctttcctgaaggcgctgcgatacgtgaatactacagtcagcaaatcgttacggtg
aaaaatggccatatcaccttaaaaccggtaactgaaagtaacggcttactgcttctggaa
cacgcagaaacgcatacttccgcccctttcgactggcataacgccacagtttactttgta
ctgacagaccgttttgaaaatggtgatcccggcaatgaccaaagttacggacgccataaa
gatggcatgcaggaaattggcaccttccacggtggtgatttacgcgggctgaccaacaaa
ctggattatctccagcaactgggcgtcaatgctttatggatcagcgccccgtttgagcaa
attcatggctgggttggcggcggtacaaaaggcgacttcccgcattatgcctatcatggc
tattacacccaggactggacgaaccttgatgccaatataggcagcgaagccgaactgcgg
gcactggttgacggtgcgcaccagcgcggtatccgaattatttttgatgtggtgatgaac
catactggctatgccacgctggcggatatgcaggagtttcagttcggcgcgttatacctt
tccggtgacgagctgaaaaaaacactgggcgagcgctggagtgactggaagcccgctgcc
gggcaaacatggcatagctttaacgattacatcaatttcagcgacaaaacaggctgggaa
aagtggtggggaaaaaactggatccgtaccgatattggtgattacgacaatcccggtttt
gacgatctcaccatgtcgctggcctttctaccggatataaaaactgaatccactaccgct
tctggcctgccggtattctataaaaacaaaccggatactcacgccaaagccatcgatggt
tatacgccgcgcgattatttaactcactggctaagccaatgggtacgcgattatggtatc
gacggattccgggtggatacggccaaacatgttgagttgcccgcctggcaacaactaaaa
accgaagccagtgccgcacttaacgagtggaagaaagctaatcccgaaaaagcgttagat
gacaattccttctggatgaccggagaagcctggggtcatggcgtgatgcaaagcgactac
taccgcaacggcttcgacgcgatgatcaatttcgattatcaggagcaagcagcgaaagcg
gtagattgcctggcacagatggacaacatctggcagcaaatggcagagaaattgcaggat
ttcaacgtactaagttatctctcctcacacgatactcgtctgttccgcgaaggtggcaaa
aaatcagcagaactgcttttactcgctcctggtgcagtgcaaattttttacggtgatgaa
tccttacgtccgtttggccccaccggttcagatccgttgcaaggcactcgttcggatatg
aactggcaggatgtcagcgataaatccgccgccagcgtcaagcactggcagcgcatcagc
cagttccgcgcccgtcacctggcaataggcgcaggcaaacaaaccacgttatctttgcca
caaggttacggatttgttcgcgaacatggcgacgataaagtgatggttatctgggcgggc
caacattaa

DBGET integrated database retrieval system