KEGG   Escherichia fergusonii: EFER_3880Help
Entry
EFER_3880         CDS       T00811                                 

Gene name
htpG
Definition
(GenBank) Hsp90xo molecular chaperone
  KO
K04079  molecular chaperone HtpG
Organism
efe  Escherichia fergusonii
Brite
KEGG Orthology (KO) [BR:efe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:efe01009]
    EFER_3880 (htpG)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:efe03110]
    EFER_3880 (htpG)
   04131 Membrane trafficking [BR:efe04131]
    EFER_3880 (htpG)
   03051 Proteasome [BR:efe03051]
    EFER_3880 (htpG)
   03029 Mitochondrial biogenesis [BR:efe03029]
    EFER_3880 (htpG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:efe04147]
    EFER_3880 (htpG)
Protein phosphatases and associated proteins [BR:efe01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     EFER_3880 (htpG)
Chaperones and folding catalysts [BR:efe03110]
 Heat shock proteins
  HSP90
   EFER_3880 (htpG)
Membrane trafficking [BR:efe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    EFER_3880 (htpG)
Proteasome [BR:efe03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    EFER_3880 (htpG)
Mitochondrial biogenesis [BR:efe03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    EFER_3880 (htpG)
Exosome [BR:efe04147]
 Exosomal proteins
  Proteins found in most exosomes
   EFER_3880 (htpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_3 HSP90 HATPase_c
Motif
Other DBs
NCBI-ProteinID: CAQ91315
UniProt: B7LVF2
LinkDB All DBs
Position
complement(3981146..3982981)
Genome map
AA seq 611 aa AA seqDB search
MSTLQLPGSSYSTEVNLNGLIEVLSKHLYSTPVVAVRELVQNGHDAIVRRRIEQPDAPKD
NQIRVVADVAKSTIIISDTGAGLTESEIHGFLATVGVGYTRMLRQQDDNTGLIGMFGLGF
LSAFVLAKEVTVLTTSWQTPDQSWKYHSTDGQKYTVTPHQSSAPGTQVILTLKEEYSHLA
SNNLLNRVLSRYCILLHEPVYVGDASEPVNKLQPPWREVAPEGVTMHRALVQRKNLAFAA
QFESSFEPICTIPVVPVGMSDAVGILWIQDGATYGTSDNRNLSLFLRGMLLDDEARELLP
PWAGFIGGVIESSKLTPTASREDLQRDETWVAVQEALKETLISGLSDLAQNQPEIWRRVL
MRHNEALLGAALCDDRLFDLLKDRLQVPTSKGALLAKDLRVNNSIHILLSRDGGFEEMLF
HILQRPVARGDRYAVVPFLRRWALLYHCRIIEVGTQTGNEQLFSLAELPEEQVAYLEEHL
CDGEQLIISRFEPAVLPLVVTPDREAELKQILEQDNADKRISTAALMLARQFTSQIQKTK
TSSLYINLNNPCIMQLVTALQHQQQPAAALRLLKSLKVILCSSGNKEQQWDLHQALEDFT
QVIPVLINQGK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagtacattacagttacctggcagttcatattctacagaagttaatttaaacggctta
attgaggtgctcagtaagcatctttactccactcccgtggttgccgtgcgcgagctggtg
cagaacggccatgatgcgatcgtgcgccgcaggattgagcagcccgatgcgccaaaggat
aaccaaattcgtgtagtggcagacgtggcgaagtccactatcatcattagcgatactggc
gctggcctcactgaaagtgaaattcatggctttcttgccacggttggcgtcggttatacc
cgaatgttgcgccagcaggatgacaacaccggtttaattggtatgttcggcctcggtttt
ttgtcagcgtttgtactggcaaaagaggtcacggtgttgaccacatcctggcaaacgccg
gatcagagctggaaataccactctaccgacgggcaaaaatacaccgttacgccgcatcag
tcctcggcgccgggaacgcaggtgattctgacgctcaaagaagagtacagccatctggcg
agtaataatctgctgaaccgcgttctttcccgctactgcatattgctgcacgaaccagtc
tatgtcggtgatgccagcgagccggtgaataaactgcaaccaccgtggcgtgaagttgcc
cccgaaggcgtaaccatgcaccgcgcgctggtacagcgtaaaaatctcgcctttgccgca
cagtttgaatcctccttcgaaccgatttgcaccattccggtggtgcccgtggggatgagc
gacgcggttgggattttatggattcaggatggcgcaacctacggcaccagcgataaccgc
aacctgtcgctgtttttgcgcggtatgttactggatgatgaagcgcgtgagttgttacct
ccctgggccggatttattggcggcgtgattgagtcatcgaaactaacgccgacggcgagc
cgggaagatctccagcgggacgaaacctgggttgcggtgcaggaggcgttaaaagagacg
ctgatttctggtttgtccgatctcgcacaaaatcagccagaaatatggcggcgtgtatta
atgcgccacaacgaagcgttgctcggtgcggcattgtgtgatgaccgtctgtttgatttg
ctcaaagatcgcttgcaggtgccaacgtcaaaaggggcgttgctggcgaaggatttacgc
gttaataacagcattcatattctgttaagccgcgacggcggttttgaagagatgttgttc
cacattctgcaacggcccgttgcccgtggcgatcgctatgccgtcgtgccatttttacgt
cgctgggcgctgttatatcactgccggattatcgaagtcggtacgcaaacgggcaatgag
cagttgttcagcctggcagaattacccgaagagcaggtggcttatctggaagagcatctc
tgcgatggcgagcaattaattatctcccgcttcgaacccgccgttttaccgttagtggtc
acgccagaccgcgaagcagaattaaaacaaattctcgaacaggataacgcagataaacgc
atcagtaccgcagcgttaatgctggcgcggcaatttacctcgcaaatccaaaaaacgaaa
acctcaagtttatacatcaaccttaataacccttgcatcatgcaactggtgacggcatta
caacaccagcaacagcccgcagcggcattacgcttattaaaatcgctgaaagtgattttg
tgctccagcggtaataaagaacagcagtgggatttacaccaggcactggaagattttact
caggttattcctgtcttaattaatcaaggaaaataa

DBGET integrated database retrieval system