KEGG   Effusibacillus sp. skT53: skT53_01950
Entry
skT53_01950       CDS       T06872                                 

Definition
(GenBank) hypothetical protein
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
eff  Effusibacillus sp. skT53
Pathway
eff00621  Dioxin degradation
eff01100  Metabolic pathways
eff01120  Microbial metabolism in diverse environments
eff01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eff00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    skT53_01950
Enzymes [BR:eff01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     skT53_01950
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_2 Esterase Peptidase_S15 Thioesterase Abhydrolase_8 Lipase_2 UPF0227 Ndr
Other DBs
NCBI-ProteinID: BCJ85210
LinkDB
Position
193217..193753
AA seq 178 aa
MGELQEKYLNTNGIATHYWEIGSGEAMILLHGGGAGADAFGNWSRIMPKFAETGFRVIAF
DAVGFGKSNKPDPQRFEYNLNARVDQLISLIRSLELDNVTLIGNSMGGATSLRAAKQQPE
LVQRLILMGTAGRLKQAQKSDRNHEFPGFRLYGRFVCVYALFPESLSSFVCTRQIHSG
NT seq 537 nt   +upstreamnt  +downstreamnt
atgggggagctgcaagaaaagtatctgaacactaacgggatcgccacacactattgggaa
atcggttccggagaagcaatgatcctgttgcacgggggtggggccggggcggatgcgttt
ggcaattggagccggatcatgccaaaatttgcagaaacaggatttcgggtgatcgcgttt
gatgctgtcggattcggcaagtcgaataaaccggatccgcagcggttcgaatacaacctg
aacgcacgggttgaccagttgatcagtctgattcgatctctcgaactggacaacgtgaca
ctgatcggcaattccatgggaggagcgacttcgctgcgggccgccaagcagcagccggaa
ctggttcaaagattaattctgatggggacggcaggccgtctgaaacaggcgcaaaaatct
gaccgaaaccatgaatttccgggtttccgattatatggaagattcgtttgcgtttatgcg
ctgtttcccgaatccctatcatcattcgtttgcactcggcaaatccactcgggataa

DBGET integrated database retrieval system