KEGG   Enterococcus faecalis OG1RF: OG1RF_12384Help
Entry
OG1RF_12384       CDS       T01882                                 

Definition
(GenBank) non-specific serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
efi  Enterococcus faecalis OG1RF
Brite
KEGG Orthology (KO) [BR:efi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:efi01001]
    OG1RF_12384
Enzymes [BR:efi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     OG1RF_12384
Protein kinases [BR:efi01001]
 Serine/threonine kinases: Other
  Bacterial family
   OG1RF_12384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr Kinase-like APH DUF3379 HlyD_D23 RIO1 Kdo Haspin_kinase Seadorna_VP7 mTERF DUF5388 UBA_6 PepSY_2 RuvA_C FTA2 PIP49_C
Motif
Other DBs
NCBI-ProteinID: AEA95071
LinkDB All DBs
Position
complement(2521837..2523993)
Genome map
AA seq 718 aa AA seqDB search
MIEIGKKLNGRYHIIGSIGSGGMANVYLAHDLILDRDVAVKVLRFDFQNDQAAIRRFQRE
ALAATELVHPNIVSVYDVGEEDGLQYLVMEYVKGMDLKRYIQTHFPIPYSTVVDITQQIL
SAVAMAHEHRIIHRDLKPQNILIDEHGTVKITDFGIAIALSETSITQTNTMLGSVHYLSP
EQARGSMATNQSDIYAVGIILYEMLTGNVPFDGESAVTIALKHFQEEIPSVKMFDPGIPQ
SLENVVRHATAKDPSDRYKTANEMAEDLYTSLSASRLNEPAWEPTALLGETKVLTPIPED
IAEPEETTPVEVPEDIADDILAEQPPKKNRKKLWIGLAIAALIALAIGGLAFAMSGGKDV
EVPDVTNETKADASQALQSAGLKVDSETKKIPDDKIEEGKVVKTDPEAKSSVKKGRSVTL
YISSGTEKIEMADYTNESYESAVEALKKLGFSEDQITTKKEYSDSVSTDNIIKQKPAAGK
KVDPKKDKVTLTVSEGPEAVTLPSYAGYSYTNAVNALAQLGISESQITRVDQASDTVEPG
LVITQDPAPGGTVTPKNGQVTLYVSKGSDKVTLSDYSGISYDNAVSRLIALGIPESQIKR
VDEESDKVEKDTVISQEPASGTAVDPKNDTITLHVSKGSDSVTVPDISGYSPKAAEDSIN
NAGLKINEQGLSGSGDGQVVERTSPSAGSKVKKGDSVTVYYSKANDSKSTTSESSTSN
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatcggcaagaagctgaatggtcgatatcacattattggcagcatcggaagc
ggcggcatggccaacgtttatttagcacacgatttaattttagaccgagacgttgcagta
aaagtcttgcgctttgacttccaaaacgatcaagccgccatccgacgttttcagcgtgaa
gcactagccgcaactgagctggttcacccgaatatcgtcagtgtgtacgatgtaggcgaa
gaagatggactacaatatttagtcatggaatatgtgaaaggaatggacttaaaacgttac
atccaaacgcatttcccaattccttattccacagttgtggacattacgcaacaaatttta
tctgctgtcgcaatggcacatgaacatagaattattcaccgggatttaaaaccgcaaaac
attctgattgacgaacacggcacagtcaaaattactgactttgggattgcgattgccttg
tcagaaacgtcaattacgcaaacgaacacaatgttaggttcggtgcattacttatcgcca
gaacaagcgcgcggaagcatggcgaccaaccaatcagatatttacgctgtgggaattatt
ctctatgaaatgctaacagggaatgtaccttttgatggtgaatcagccgtaacgattgcc
ttaaaacatttccaagaagaaattccttctgtcaaaatgtttgatccaggaattcctcaa
tcattggaaaatgtggttcgtcatgcaaccgcaaaagacccaagcgatcgctacaaaaca
gcgaatgagatggcagaagacttatacacgtccttgtcagccagtcgtttaaacgaacct
gcgtgggaaccaacggctttattaggagaaacgaaagtattaactccgattcccgaagac
atcgctgaaccggaagagacaacgcctgtcgaagtcccagaagatatcgcagatgacatt
ttagctgaacaaccaccgaagaaaaaccgcaaaaaattgtggattggcttagcaattgcg
gcattaattgctttagcaataggtggcttagcctttgcaatgtcgggtggtaaagacgtt
gaagttcctgatgttacaaatgaaacgaaagcggacgcttcacaagcgctacaaagtgcc
gggctgaaagtcgatagtgaaaccaaaaaaattcccgatgataagattgaagaaggcaag
gtggtcaaaacagaccccgaagcaaaatcatctgtgaaaaaaggccgatctgttacttta
tatatcagctctggaacagaaaaaattgagatggccgattatacaaacgaatcgtatgaa
tctgctgtcgaagccttgaaaaaactagggttttcagaagaccaaattacaacgaaaaaa
gaatacagtgattctgtgtctacagataacattattaaacaaaaaccagctgcaggtaaa
aaagttgatccgaaaaaagacaaagtcactttaacggtcagtgaaggaccagaagcggtt
actttgcctagttacgccggttattcttacacaaatgcagtaaatgcactggcacagtta
ggcatttctgaatctcaaattacgcgtgtcgaccaagcaagcgatacggtagaaccaggt
ttagtcattacgcaagaccccgcaccaggtggcaccgtgacacctaaaaatggccaagtg
acgttatatgtaagtaaaggtagcgacaaagtgacactttctgattatagcggaatttct
tacgataatgcggtaagtcgcttaattgctttaggtattccagaatctcaaattaaacga
gtggacgaagaaagcgacaaagttgaaaaagataccgtgattagtcaagaaccagcttct
ggtaccgctgttgatccgaaaaatgacacgattactttacatgtcagcaaaggcagcgac
tcagtaactgttcctgatatttcaggttattcgccaaaagctgcagaagacagcatcaat
aacgctggccttaaaatcaatgaacaaggattatctggctctggcgatggccaagtcgtt
gaacgaactagcccatccgctggcagcaaagtcaaaaaaggcgactctgttacagtttat
tattcaaaagcaaatgattcaaaaagcaccactagtgaaagtagtacgagtaattaa

DBGET integrated database retrieval system