KEGG   Enterococcus faecalis 62: EF62_2046Help
Entry
EF62_2046         CDS       T01881                                 

Definition
(GenBank) MarR family protein
  KO
K15973  MarR family transcriptional regulator, 2-MHQ and catechol-resistance regulon repressor
Organism
efl  Enterococcus faecalis 62
Brite
KEGG Orthology (KO) [BR:efl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:efl03000]
    EF62_2046
Transcription factors [BR:efl03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    EF62_2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 TrmB HTH_34 HTH_24 Penicillinase_R MMR_HSR1_C DUF480 PemK_toxin HxlR LexA_DNA_bind FtsK_gamma
Motif
Other DBs
NCBI-ProteinID: ADX80268
LinkDB All DBs
Position
2031647..2032075
Genome map
AA seq 142 aa AA seqDB search
MNQQQEALKAYIGLLRTSHRLEQLAKQDVTCYDLNITEFSVLELLLHKGPQTIQKIKEKI
LIASSSTTYVIDQLHKKGYVTRTPSEKDRRITYVELTEAGKTLIEEIFPMHAKRIAEAFE
QLSSEELTLLQKTLRKITNETK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacagcaagaagctttaaaagcctatatcggtttattaagaaccagccatcga
ctagagcaacttgccaagcaagatgttacttgttatgacttaaacattacagaattttca
gtgttagagctgttactccataaaggtcctcagaccatccaaaaaatcaaggagaaaatt
ttaatcgctagcagtagcaccacttatgttattgaccaattacataaaaaaggctatgta
acgcgcactcccagtgaaaaagaccgacgcattacttacgtcgaattaacagaagctgga
aaaacattaattgaagaaattttcccgatgcatgcaaagcgaattgcagaagcatttgaa
caactctcttccgaagaattaacacttcttcaaaaaactttacgaaaaataacaaatgaa
acgaaatga

DBGET integrated database retrieval system