KEGG   Enterococcus faecalis 62: EF62_2420Help
Entry
EF62_2420         CDS       T01881                                 

Gene name
cydD
Definition
(GenBank) ABC transporter, cysteine exporter CydDC family protein, CydD subunit
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
efl  Enterococcus faecalis 62
Pathway
efl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:efl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EF62_2420 (cydD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:efl02000]
    EF62_2420 (cydD)
Transporters [BR:efl02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    EF62_2420 (cydD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_21 AAA_16 DUF87 RsgA_GTPase AAA_29 NB-ARC MMR_HSR1 DUF4191 DUF3099
Motif
Other DBs
NCBI-ProteinID: ADX80630
LinkDB All DBs
Position
complement(2380648..2382414)
Genome map
AA seq 588 aa AA seqDB search
MMEKQPTTKDVWKNDQWVRPFLKRYKKTLYFALLLGFLTFFSAGALMFTSGYLISRAASL
PENILLIYIPIVLTRAFGIGRPVFRYVERLTSHNWVLKMTSDLRLKLYNVLEKDAIFFKT
KYRTGDILGLLSEDINHIQNLYLRTIFPTVIAWILYIFLVIALGFFSWWFALCMLLMLGV
VVFLLPLVSVLVNGARQEKHKYAKNELYQTLTDNILGVSDWVFSQRGSEFVARYETDEAN
VRALDEKMKQFNRGRDFVLQLLFGVIAIAVLAWTSVRFPGNHGGAANWIGAFVLTVFPLI
DAFAPLPAAAQETTIYKDSIRRFNELPEGEDDSTEAPVQPNGTSLSIEHLSFAYENQEKK
VLNDLSLTIPEKQKLAILGRSGSGKSTLASLIRGDLRPTSGEILLGNIPTEAFGETMTEY
IGVMHQAPYLFRTTILNNIRIGREEASEAEVWAVLEKVGLKEMVAQLPEGLQTMVDEAGL
RFSGGERHRLALARILLQDTPIVLLDEPTTGLDPITEQQLLETFFEALKDKTVIWITHHL
QGVTLMDQVIFIEDGQLEMSGTPEELLATNAHYQKLYRIDRGISSFEE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaaacagccgacaacgaaagacgtttggaaaaacgatcaatgggttcgtcct
ttcttaaaacgctataaaaaaaccttgtattttgccttacttttaggcttcttgacgttc
tttagcgcaggggcattaatgtttacgtctggttacttaatcagtcgtgcggcttcctta
ccagagaatattttattaatttatattcccattgttttaacaagagcattcgggattggc
cgtcctgtttttcgttatgtggagcgtctaacgagtcataactgggtgttaaaaatgacc
tctgatctgcgcttgaaactttataatgtactagaaaaagatgcgattttctttaagaca
aaatatcgcactggggatatcttaggtttgctttcggaggatattaatcatatccaaaac
ttgtatttacgaacgattttcccaaccgttattgcttggattttgtatatctttttagtg
attgcgttaggtttcttttcttggtggtttgctttatgcatgttactgatgttaggagtg
gttgtttttctattgccacttgtttcagttctagtgaatggtgcgcgtcaagaaaaacat
aaatatgccaaaaatgagttatatcaaacactaaccgacaatattctaggtgtgtctgat
tgggtatttagtcaacgaggctctgaattcgttgctcgttatgaaacagatgaagcaaac
gttcgtgcattagatgaaaaaatgaagcaatttaaccgtggccgagactttgttttacaa
cttctttttggtgtgattgcgattgctgtcttagcttggactagtgtgcggtttccaggt
aatcatgggggcgcagccaattggattggtgcctttgttttaaccgtttttccgttaatt
gatgcttttgctccgctacctgctgctgcacaggaaacaacgatttataaggattccatt
cgtcgttttaatgagcttcctgaaggggaagatgactcaacagaagcgcctgttcagcca
aatggcaccagtttatcgatagaacatttgtcttttgcatatgaaaatcaagagaaaaag
gtattaaatgacttatcgttaacaattcctgaaaaacaaaaattagcgattttagggcgc
agtggttccggaaagagtacgttggcttcgctcattcgtggtgatttacggcctacttcg
ggagaaatccttttaggaaatatcccaactgaggcatttggtgagacgatgactgaatat
attggggttatgcatcaagcgccgtacctatttcgaacaaccattttaaataatattcgg
attggtagagaagaagcaagcgaagcagaagtttgggcggttttagaaaaagttggctta
aaagaaatggttgcccaattaccagaaggtttacaaacaatggtggatgaagcaggttta
cgtttttctggtggcgaacgacatcgcttggcgctagcgcggattcttttgcaagataca
ccgattgtgttattagacgaaccaactactggtttagatccaattacagaacagcaattg
ctggaaaccttttttgaggcattaaaagataaaaccgtcatctggattacccaccatttg
caaggcgtaactttgatggatcaagtgatctttattgaagatggccaattagagatgagt
ggtacgccagaggaattacttgcaaccaatgcgcattatcaaaaactttaccgaattgat
cgtggcattagttctttcgaggaataa

DBGET integrated database retrieval system