KEGG   Enterococcus faecium ATCC 8459 = NRRL B-2354: M7W_1262Help
Entry
M7W_1262          CDS       T02454                                 

Definition
(GenBank) Aspartyl-/Glutamyl-tRNA(Asn, Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
efm  Enterococcus faecium ATCC 8459 = NRRL B-2354
Pathway
efm00970  Aminoacyl-tRNA biosynthesis
efm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    M7W_1262
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:efm03029]
    M7W_1262
Enzymes [BR:efm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     M7W_1262
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     M7W_1262
Mitochondrial biogenesis [BR:efm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    M7W_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGE29886
LinkDB All DBs
Position
1096880..1098352
Genome map
AA seq 490 aa AA seqDB search
MTELHNRSLEELHHMLVSKEITVQDLTKATFERIKETEPEVEAFITLNEEKALEQAKALD
EKGIDESNVLAGIPIGIKDNIVTKDILTTAASKILYNFEPIYDATVMDKIYQADMIPVGK
LNMDEFAMGGSTETSYFKKTKNAWDPTKVPGGSSGGSAAAVAAGQIPVSLGSDTGGSIRQ
PAAFNGIVGMKPTYGRVSRFGLIAFASSLDQIGPMTRTVKDNALALTAISGYDEKDGTSS
GVSVPNFAEGLTGDIKGMKIALPKEYLGEGVAPGVKEAVLKAAETFRSLGAVVEEVSLPH
SKYGVAVYYIIASSEASSNLQRFDGIRYGYRSENVKSLDDVYVNSRSEGFGEEVKRRIML
GTFSLSAGYYDAYFKKAGQVRTLIKRDFEKVFADYDLIIGPSSPTVAFGIGENINDPITM
YMSDILTIPVNLAGLPGMSVPAGLSEGLPVGLQIIGNYFDEKTMYQAAYAFEQATEFHTQ
QPAILGGKDE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacagaattacacaatcgttctctagaagaactgcatcatatgcttgtatcgaaagaa
atcactgtacaagatttgacaaaagcaacatttgaacgaatcaaagaaacagagcctgag
gtcgaagcattcattacattgaacgaagaaaaagcattggaacaggcaaaagctttagat
gaaaaagggattgatgaaagcaacgtccttgctggtattccaattggtatcaaggataat
atcgtaacaaaagatatcttgacaaccgctgcatctaagatcctttacaattttgaacca
atttatgatgcaacggtcatggataaaatctatcaagcagatatgatccctgttggtaag
ctaaacatggatgaatttgctatgggtggaagtacagaaacttcttatttcaagaaaaca
aaaaatgcttgggacccaacaaaagtacctggtggctcttctggtggttctgcagcagca
gttgcagctggacaaattccagtttctttaggtagtgatactgggggaagtatccgccaa
ccagcagcttttaacggcatcgtagggatgaaacctacttatggccgtgtctcacgtttt
ggtttgattgcctttgcttcatctcttgaccaaattggaccaatgacccgtacggtgaaa
gataatgcattagcattgacagctatcagcggttatgacgaaaaagacggtacttcttca
ggcgtttcagttcctaattttgcagagggactgacaggcgacatcaaaggaatgaagatt
gctttacctaaagaatacttaggcgaaggtgtagcccctggcgtaaaagaagctgtattg
aaagcagcagaaacattccgttcattaggtgctgttgtggaagaagtcagcttgcctcat
tcaaaatacggtgtggctgtttattatatcattgcctcatcagaagcaagttccaacttg
caacgattcgatggtatccgctacggttatcgctctgaaaatgtgaaatcattagatgat
gtatatgtcaactcacgttcagaaggattcggtgaagaagtaaaacgccgtatcatgtta
ggtacattctccttaagtgcgggttattatgacgcttacttcaaaaaagcaggacaagtc
cgtacattgataaaacgagattttgaaaaagtctttgcagattatgacttgattatcggg
ccatcttcaccaacagtggcattcggaatcggtgaaaacattaacgatccaatcacaatg
tacatgagtgacatcttaacgatccctgtcaacttggctggacttccaggtatgtctgta
ccggcaggattgtcagaaggattaccagttggattgcagatcatcggtaattattttgat
gaaaaaacgatgtatcaagcggcatatgcgtttgaacaagcaacagaattccacacacaa
caaccagctattttaggagggaaagacgaatga

DBGET integrated database retrieval system