KEGG   Enterococcus faecium ATCC 8459 = NRRL B-2354: M7W_1473Help
Entry
M7W_1473          CDS       T02454                                 

Definition
(GenBank) Multidrug resistance efflux pump PmrA
Organism
efm  Enterococcus faecium ATCC 8459 = NRRL B-2354
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_3 BT1
Motif
Other DBs
NCBI-ProteinID: AGE30095
LinkDB All DBs
Position
1302772..1303968
Genome map
AA seq 398 aa AA seqDB search
MEINWRKNLVIAWIGCFFTGASISLVMPFIPVYVEQLGTPKDQIELFSGLAISVTAFASA
VVAPIWGNLADRKGRKLMMIRAAAGMTLTMGSLAFVPNAYWLLIMRFWNGILSGYIPNAT
AMIASQAPREKSGWALGTLSTGAIAGNLIGPSMGGALAQWFGMENVFLITGALLMITTVL
TIFLVKEDFHPIEKKDLISTKEIFSKMDHLSILIGLFITTLILQIGITTISPILTLYIRE
LSGSTENILFVSGLIVSIAGVSAVFSSPKLGKLGDKIGNQKVLIGGLILSFCCYLPMAFV
TTPLQLGILRFILGFSTGALMPSVNTLISKITPQEGVSRIYSYNQMFSNFGQVLGPMLGS
TVAHAYNYSAVFIVTSLFVLSNILLSLFNFRKVLRSRL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagattaattggagaaaaaatttagtgattgcgtggattggctgttttttcactggt
gcaagtattagtttagttatgccattcataccagtttatgttgagcaactaggaacacca
aaagatcaaatcgaattgttttcgggactagcaatctctgtgactgcttttgcatctgcc
gtggttgcaccaatctggggaaatctagctgatcgaaaaggccgaaaactcatgatgatc
cgtgcagcagcagggatgacattaacaatgggatctttggcttttgtaccgaacgcgtat
tggcttttgatcatgcggttttggaatgggattttgtctggatatattccaaatgccaca
gcgatgattgcttcacaggcacctagagaaaagagcggatgggcgttaggaacattgtct
accggagcgattgctggaaatctgatcggaccttcaatgggcggtgcactggctcagtgg
tttggtatggaaaatgtattcttgatcacaggggctttgttgatgatcacaacggtattg
accattttcttagtcaaagaagatttccatccgatcgagaaaaaagatctgataagcacc
aaagaaattttttcaaaaatggatcatctctctattttgatcggtctcttcattacgacc
ttgattttacagataggaatcactacgatcagccctattttgaccttatatattcgtgaa
ttgagcggaagtacagaaaatatcctttttgtcagcggcttgattgtttcgatagctggt
gtttccgctgtcttttcttcaccgaaactaggaaaactaggggataagattgggaatcaa
aaagttctaattggaggactcattttatcattttgctgttatttacctatggcattcgtc
actacaccgctccaattaggtatacttcgctttattttaggcttttcaactggcgctttg
atgccttctgtcaatacactgatcagtaagattacgcctcaagaaggagtcagccgaatc
tatagctacaatcagatgtttagcaactttggacaagttttaggtcccatgctaggatcg
acagtcgcgcatgcttataattacagtgctgtttttattgtgacaagtttgtttgttctg
tcaaatattcttctttctttattcaactttcgtaaagttcttcgcagcagattataa

DBGET integrated database retrieval system