KEGG   Enterococcus faecium NRRL B-2354: M7W_2318Help
Entry
M7W_2318          CDS       T02454                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
efm  Enterococcus faecium NRRL B-2354
Pathway
efm00240  Pyrimidine metabolism
efm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M7W_2318
Enzymes [BR:efm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     M7W_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK DUF4371 AAA_14 KdpD AAA_22 AAA_30 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AGE30917
LinkDB All DBs
Position
complement(2173213..2173797)
Genome map
AA seq 194 aa AA seqDB search
MAQLFFKYGAMNSGKTIEILKVAHNYEEQNKPVVLMTSGIDTRDGLGVVSSRIGLKRNAM
PIFEETDVFDVIQKMESKPYCVLIDEAQFLKKKHVIAFTRIVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCHKKAIMNLHYIDGNPVYEGDQVQIGGNEAYYPVC
RKHYFHPSMITEGE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactattttttaagtatggcgcaatgaatagcggcaagacgatcgagatccta
aaagtcgcacataattatgaagaacaaaataagccagttgtcttaatgacaagcggtatt
gatacaagagatggtttaggcgttgtttcaagccgaatcggactgaaacgtaatgcgatg
ccgatatttgaagaaacagacgtatttgacgtaattcagaaaatggaaagcaaaccctat
tgtgtgctgatcgatgaagcgcaattcttaaaaaagaaacatgtcattgcttttacgaga
attgtggacgaattggatattccggttatggcatttggtttgaaaaatgattttcgaaac
gagttatttgaaggatcaaaatatttattgctttatgcagacaaaatcgaagaaatgaaa
acaatctgttggttctgccacaaaaaagcaatcatgaatttacattatattgatggaaac
cctgtttatgaaggcgatcaagtgcaaattggcggaaatgaagcttattaccccgtttgt
cgaaaacattactttcacccatcaatgattacagaaggagaataa

DBGET integrated database retrieval system