KEGG   Enterococcus faecium ATCC 8459 = NRRL B-2354: M7W_2575Help
Entry
M7W_2575          CDS       T02454                                 

Definition
(GenBank) Serine, threonine protein kinase PrkC, regulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
efm  Enterococcus faecium ATCC 8459 = NRRL B-2354
Brite
KEGG Orthology (KO) [BR:efm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:efm01001]
    M7W_2575
Enzymes [BR:efm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     M7W_2575
Protein kinases [BR:efm01001]
 Serine/threonine kinases: Other
  Bacterial family
   M7W_2575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Kdo Haspin_kinase RIO1 Seadorna_VP7 DUF4366 FTA2 Pox_ser-thr_kin
Motif
Other DBs
NCBI-ProteinID: AGE31169
LinkDB All DBs
Position
complement(2479693..2481762)
Genome map
AA seq 689 aa AA seqDB search
MIELGKKLNGRYQITGNIGSGGMANVFLAHDLILDRDVAVKVLRFDFQNDQTAIRRFQRE
ALAATELVHPNIVSVYDVGEEDNMQYLVMEYVKGMDLKRYIQTHYPVPYETAVNIMQQIL
SAISLAHNHQIIHRDLKPQNVLIDNEGVVKITDFGIAIALSETSITQTNTMLGSVHYLSP
EQARGSMATKQSDIYALGIILYEMLTGSVPFDGESAVTIALKHFQDDLPSIKALDPNVPQ
ALENVILRATAKEPADRYKSAEEMSDDLSTVLSPARANEEKWQPHVMDNETKVITPLTED
APMPDSFKSMPLPKDKPENETLPEEEEVLPDPKKKGQKKWWLILLAILAVLGIGTAVFFA
SGGRGEVVVPDVSDLSEASARETLAKAKLEVATKTEEIADDKIEEGNVVKTDPAAGTTVK
QKREVTLYISSGTKKIKLDDYSGKSYEDAEASLKELGFSADLIQKEEEFSSEVESGMIIS
QSPSEDTEVDPKTDTITFTVSKGPETVTLSSHVGENYETVRNWLVTQGFNINNISATYDY
SDTVPSGSIISQDPASGEVVAEETYINFVVSQGTEPKLNDISGYTKSEAQSYLASVGAEY
IGHETSEYSNTVDKDKVIRTVPGAGTTITKGMVVNVIYSKGPDPASSSSEKDSSDSSSSS
SSSSSTSNSSKEESSSSTSSSASTSESSK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagttgggcaaaaaattaaatggccgttatcaaatcactggaaatatcggtagc
ggtggtatggcaaatgtatttttggcgcacgatttaatcttggatcgtgatgtagcagtt
aaagtcttacgatttgactttcaaaatgaccagactgcgattcgacgatttcagagagaa
gctttagcagcaacagaactcgttcatccaaacattgttagtgtttacgatgttggtgaa
gaagacaacatgcagtatctggtgatggaatacgtcaaaggaatggacttgaaacgatat
atccaaacacattatcctgttccttatgaaacagcagtaaatattatgcagcagatcctt
tctgctatttctttagctcataaccatcaaatcatccaccgagatttgaaaccccaaaac
gtactgatcgataatgaaggtgttgtaaaaatcacggatttcgggattgctatcgcttta
tctgaaacatcgatcacgcagacgaatacgatgctaggatctgttcattatctgtcccct
gagcaggccagaggaagtatggcaacgaagcagtcagatatttatgctttagggatcatc
ctttatgagatgttgacgggtagcgtaccgtttgatggtgaatctgctgtaacaattgct
ttaaaacattttcaagatgatcttccatctataaaagcacttgatccaaatgtgccacaa
gcactggaaaacgtgattttacgggcaacggctaaagaacctgcagaccgttataagtca
gccgaggaaatgtctgatgatctttctacagtattatcaccagctcgtgcaaacgaagaa
aaatggcagcctcatgtgatggataatgaaacaaaagttatcacaccccttacggaagat
gcaccaatgcctgattcattcaaatctatgcctctgccaaaagacaagccagaaaacgaa
accttaccagaggaggaagaagttctgcctgatcctaaaaagaaaggacagaaaaaatgg
tggctgatcctattagctattcttgctgttttaggaatcggaacagctgtattctttgct
tctggcgggcgaggagaagttgttgttcctgatgtttctgatctttctgaagcttctgct
agagaaacactcgcaaaagcgaaattagaagtagcaacaaaaacagaagaaattgcagat
gacaaaatcgaagaaggtaatgtagtgaagacagacccggcagcgggaacgacagtcaag
caaaaacgcgaagtcactctgtatattagtagcggcacgaaaaaaatcaaattagatgat
tacagtggtaaaagttatgaagatgccgaagcaagtttgaaagaattagggttttctgct
gacttgattcaaaaagaagaggaattcagttcagaggtagaaagcggaatgatcatttcg
caatctccatcagaagatacagaagtcgatcctaaaacagacacgattactttcacagtc
agcaaaggaccagaaacagtgactttgagtagtcatgtaggagaaaactacgaaactgtt
cgtaattggcttgttacacaaggattcaatatcaataatattagtgctacttatgactat
agcgacactgtaccatcaggttcgatcatcagtcaggatccagcctcgggtgaagttgta
gcagaagaaacttacatcaattttgtcgtaagccaaggaacagagcctaaattgaatgat
atctccggctatacaaaaagcgaagcacaaagttatttagctagtgtcggtgcagaatat
atcgggcatgagacttccgaatattcaaacacggtggataaagataaagtgattcgtaca
gtaccaggggcaggaacgacaattaccaaaggaatggttgtgaacgtaatttactctaaa
ggaccagatccagcgtcttctagttctgaaaaagactcttcagacagttctagcagctca
agtagctccagtagcacaagcaactcttcaaaagaagaatcttccagctccacaagttca
tcagctagcacctcagaaagttcaaaataa

DBGET integrated database retrieval system