KEGG   Enterococcus faecalis DENG1: DENG_00232Help
Entry
DENG_00232        CDS       T03043                                 

Definition
(GenBank) Aldehyde dehydrogenase
Organism
efn  Enterococcus faecalis DENG1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC Sigma54_activ_2
Motif
Other DBs
NCBI-ProteinID: AHI39349
LinkDB All DBs
Position
204050..205540
Genome map
AA seq 496 aa AA seqDB search
MSKKEINQVVASSYQLYINGEWTTGSGNKMIASYNPSNGEKLAEFVDATNADVDRAVEAA
QEAFQIWKDVDVVTRSNLLLKIADLIEENQEHLAMVETLDNGKPLRETQSIDVPASADHF
RYFASVIRGEEGSVKEFDKDTLSIVVKEPIGVVGQIIPWNFPLLMGAWKLAPALAAGNTV
VIHPSSSTSLSLLELFKIFDQVLPKGVVNLITGRGSDSGNYMLAHPGFDKLAFTGSTEVG
YTVAKAAADRLIPATLELGGKSANIIFEDANWERALEGVQLGILFNQGQVCCAGSRVFVQ
SGIYDQFVEALKEKFEQVNVGFPWEKDVEMGAQINEHQLEEILKYVEIGVKEGATLITGG
QRLTENGLDKGAFLAPTLLANGTNTMCVAQEEIFGPVATVIKFETEEEVIRLANDSEYGL
GGAVFSQDINVALRVARGVRTGRMWVNTYNQLPAGAPFGGYKKSGIGRETHKSMLDAYTQ
MKNIYIVTKEEADGLY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagaaataaatcaagtagttgccagtagctatcaattgtatattaatgga
gagtggacaacaggtagtggtaacaaaatgattgctagttacaatcctagtaatggcgaa
aaattagcagaatttgttgatgccacaaatgcagatgtggatcgagctgtagaagcagcc
caagaagcgtttcagatatggaaagatgttgacgttgtaacaagaagcaatcttttgttg
aaaattgctgatttgattgaagaaaatcaagaacatttggctatggtggagactttagat
aatggaaaaccgcttcgggaaacgcaatcgattgatgtccctgccagtgcagaccatttt
cggtattttgctagtgtgattcgtggagaagaagggtctgtcaaagaatttgataaggat
acgttatccattgttgtgaaagaacccattggtgttgtgggtcaaattattccgtggaat
ttccccttattaatgggtgcttggaaattagcaccagcgttggcagcaggtaatacggtt
gtgattcatccgtcctcgagcacatcattaagtctgttggaattgtttaaaatttttgat
caagtcttgccgaaaggagtagtgaatttaatcaccggtcgtggttctgattcaggaaat
tatatgttggcacatccagggtttgataagctagcttttacaggttcaacagaggtgggg
tacactgtcgctaaagctgcggccgaccgcctaattccagccactttagaacttggcgga
aaatcagccaacattatttttgaagatgccaattgggaacgtgcattagaaggcgtgcag
ttagggattttattcaatcaagggcaagtttgttgtgctgggtctcgtgtgttcgttcag
tcaggtatttatgatcaatttgtagaagctttaaaggaaaagtttgaacaagtgaacgtt
ggtttcccgtgggaaaaagatgttgaaatgggcgctcagatcaatgagcatcaattggaa
gaaattttaaaatatgtcgaaattggtgtgaaggaaggagctacactgattactggtggg
caacgtttaacagaaaatgggctagacaagggggcgtttttagcacctacgttattagcg
aacggcacgaatacaatgtgcgtggcccaagaagaaatctttggtcctgttgcaacagtg
attaaatttgaaacggaagaagaagtcattcgtttagctaatgattctgaatatggtcta
ggtggtgccgtcttttctcaagatatcaatgtggcattacgggttgctcgtggtgtacgg
acaggtcggatgtgggtcaacacatacaatcaattgcctgcgggcgcgccatttggcggt
tataaaaaatcaggaattggtcgagaaacgcataaatcaatgctagatgcttatacgcaa
atgaaaaatatttacattgtgacaaaagaagaagcagacggactgtattaa

DBGET integrated database retrieval system