KEGG   Enterococcus faecalis ATCC 29212: DR75_1708Help
Entry
DR75_1708         CDS       T03320                                 

Definition
(GenBank) PTS system sorbose-specific iic component family protein
  KO
K17466  D-glucosaminate PTS system EIIC component
Organism
efq  Enterococcus faecalis ATCC 29212
Pathway
efq00030  Pentose phosphate pathway
efq01120  Microbial metabolism in diverse environments
efq02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:efq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DR75_1708
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    DR75_1708
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:efq02000]
    DR75_1708
Transporters [BR:efq02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   D-Glucosaminate-specific II component
    DR75_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EII-Sor
Motif
Other DBs
NCBI-ProteinID: AIL05385
LinkDB All DBs
Position
complement(1730388..1731137)
Genome map
AA seq 249 aa AA seqDB search
MGVLGVSIIMGLYYWFARLRFGYTFSGMLSQPLGAALVAGLATGKLSEAMVVGAGIQLVY
LGVTSTPGGNVPSDPALASAIAIPIALGVGMNAEAAVALAVPFGVLGVFMDQLRRTINAT
WVHMADKYAEELNYGGIYRAAFVYPALAGFLIRFPLVFAANFFGQSVVNKVLEVIPAWLM
HGFEVMGGILPALGFALTIMVIGKKNLIPYFLIGFVAVVYFGAEVMAVAILGICIAFLVR
NKALSEEAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttttaggtgtttcaattattatgggactttattattggtttgcacgtttgcgt
tttgggtacacattttcaggcatgctgtctcagccattaggtgcagcgttggtggctggt
ttagcaacaggaaaacttagtgaagcaatggttgtgggggcggggattcaacttgtttat
ctcggagtcacctccacaccgggcggcaatgtgcctagtgatccggctttagcttcagca
attgcgattccaattgctttaggtgtgggaatgaatgccgaggcggctgttgcactagct
gttccttttggtgtgttaggcgtctttatggatcaattacggcggaccatcaatgcgacg
tgggtgcatatggctgataaatatgcagaagagttaaattatggggggatttaccgagct
gcgtttgtttatccagctttagcgggatttttaattcgctttcctttggtttttgcggcg
aacttttttggtcaatccgtggtgaataaagtcttagaagttatcccagcatggttgatg
cacggctttgaagtaatgggtggtattttaccagcgttaggcttcgccttaacaattatg
gtaattggcaagaaaaatttgattccttattttttaattggttttgttgcagtagtatat
tttggcgcagaagttatggccgtcgctattttaggaatctgtattgcctttttagttaga
aataaggcattgagtgaggaggcagcataa

DBGET integrated database retrieval system