KEGG   Enterococcus faecalis ATCC 29212: DR75_2682Help
Entry
DR75_2682         CDS       T03320                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
efq  Enterococcus faecalis ATCC 29212
Pathway
efq00970  Aminoacyl-tRNA biosynthesis
efq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:efq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DR75_2682 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:efq03029]
    DR75_2682 (gatB)
Enzymes [BR:efq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DR75_2682 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DR75_2682 (gatB)
Mitochondrial biogenesis [BR:efq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DR75_2682 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AIL04536
LinkDB All DBs
Position
2723550..2724980
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNSNTNVVDWSYPGVLPVMNKGALEFGM
KAALALNCEISKETHFDRKNYFYPDNPKAYQISQFDQPIGHDGWIEIEVEGKKKKIRIER
VHLEEDAGKNIHGTDGYSYVDLNRQGTPLIEIVSEADMRSPEEAYAYLEALRSIIQFTEV
SDVKMEEGSMRCDANISLRPYGQEEFGTKAELKNLNSMNFVKKGLAYEEKRQAKVLLSGG
EIQQETRRFDEATSTTLLMRVKEGSSDYRYFPEPDVPRFSIDDEWIEKVRASLPEMPASR
RARYISELGLPEYDAMVLTLTKEMSDFFEATLANGADAKQASNWLMGEVSAYLNSEKVEL
ADTKLTPENLAGMITLINDGTISSKIAKKVFKELIENGGDAKEVVEAKGLVQLSDPAQLL
PMINEVLDNNQQSIDDFKNGKDRAVGFLVGQIMKATRGQANPGVVNKLLQEELSKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaactgtcattggattagaagtccacgtagaattgaaaaccaactctaaa
attttctcctctgcgccagcgcatttcggagcagaaccaaatagcaacacaaatgtggtt
gactggagttacccaggtgttttgcctgtcatgaataaaggtgccttagaatttggcatg
aaagcagcacttgccttgaactgtgaaatttcaaaagaaacacattttgaccgtaaaaac
tatttttacccagataacccgaaagcataccaaatttctcaatttgatcaaccaatcgga
catgatggttggattgaaattgaagtcgaaggcaaaaagaaaaaaattcgcattgaacgg
gtgcatttagaagaagatgctgggaaaaatattcacggcacagatggctattcttatgta
gacttgaatcgtcaaggtacgcctttaattgaaatcgtttctgaagcagacatgcgctca
ccagaagaagcgtatgcttatttagaagcgttgcgttcaattatccaatttacagaagtt
tctgatgtgaaaatggaagaaggttctatgcgttgtgatgccaatatttctttacgtccg
tatggtcaagaagaatttggtactaaagcggaattaaagaacttgaactctatgaacttt
gtaaaaaaaggtttagcttatgaagaaaaacgccaggccaaagtcctattatctggtggc
gaaattcaacaagaaacacgccgctttgatgaagcaactagtacaacgttgcttatgcgt
gttaaagaaggctcaagtgactaccgttacttcccagagccagatgttcctcgtttttca
attgatgatgaatggattgaaaaagttcgcgctagtttgccagaaatgccagcctcacgt
cgtgcccgttatatcagtgaattagggttacctgaatacgacgcaatggtcttaacttta
acgaaagaaatgtcagatttctttgaagcaactttagcaaacggtgcagatgcgaaacaa
gcatcaaactggttaatgggcgaagtttctgcttacttaaacagtgaaaaagttgaatta
gccgatactaaactaacaccagaaaatctagcgggtatgattactttgattaacgatggc
acaatcagctcgaaaattgcgaagaaagtgttcaaagagttaattgaaaacggtggagac
gctaaagaagttgtcgaagcaaaaggtttggttcaattatctgatccagcgcaattatta
ccaatgattaacgaagttttagacaacaaccaacaatcaattgatgactttaaaaacgga
aaagaccgtgcagttggtttccttgttggacaaattatgaaagcaactcgtggacaagca
aacccaggtgtggttaacaagttattgcaagaagagctttcaaaacgataa

DBGET integrated database retrieval system