KEGG   Enterococcus faecalis ATCC 29212: DR75_396Help
Entry
DR75_396          CDS       T03320                                 

Gene name
esaA
Definition
(GenBank) type VII secretion protein EsaA
Organism
efq  Enterococcus faecalis ATCC 29212
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIL03358
LinkDB All DBs
Position
386460..389897
Genome map
AA seq 1145 aa AA seqDB search
MEGKIKKGIPFALAIGATFLLLLFFIHLGFKDENVTRSSKDQTTKMQYALVNEDKGASFE
GKRYALGSDFVTLINKDTANRWETTTRNIATSGVENGQFDAQIIIPQDFSEKLLSLQAVS
PEQASVEYQVRDGQNELTNQAIQDKVNTILKDFNQRVIQMYFSSIVGNLVIAQQNVNQIT
DTQLLYQNQLEETIQQPFKEIPMNYTTVLSTASILDEDNKLFTNEQEAFVKSVQTLLESN
SRSLESTSKTTEDTKKSVDEYSKEANEKIKKSIAQFNEQFERQKQELTNQWESDTTVYKQ
QFDQLNGMVINQFSSFYTPSEQGSSGIYADFLSESKLFQETQGNRIGELQKEIAELHMQV
EQLTALKKQIAATYYNDLEATPEIATDTQIKQAIIQLITNEKENIPNLDKNYQERLEESL
SEISFVSLERLVSELEMNNRISVEQGNLFRDELQIIQRYAEQHELDFTNSSRFMYLEPKQ
LHEDTIAIPQEKVTFSLATNQESVISLRQTNTQNGELSFLLDDSKVQTIKTSLNQQLAGT
GYSIDISAITPTQLTITKPVKIQAEIPENDEVDEENTQEELAEESEDESEKVTEPVNDLL
SLPEKLSLTIDLPMSWQLTPEQQKTAFNQIDYSWWVNNELQNARSFAVYIAMDQPLVTDI
PEIMKQFQLLDTVSQQIVTLYGTPNQSLSIQEYAAMLTAPENQDKTIEELAGETSIYWMY
DNITENEQTMMITDKLLDEYKKTGNQLYRETDEQINQLKQLIGTETDQNTDGRPTTLYGT
LNLMTVPEKLLREAEKLNTWFDEATKQVNATYATWQEAGKVGATSVIDERNPHPEESQTS
TLDVETENLVKMMQTLMQTTKETSLTTADSAAKVKDVAQTIKELKASTTKVQDHAQNILA
NLNDSIDESKKTTKENEEYAKTFEKVLANTRDGGADNPRVFSFLASPIQGEGIFGETRQV
SLIPYYATLIVSILTFVIALTFQGFMKKRTVTVADALVEPTRVWQNIPNLLLLLITVILF
GSVFSLLLVFNVSQINRFAWFSYSFLVFASGALLVCACLRQFKKLTLYVYGAMLGLFFML
TPLLGIATKVGSLSNWLYRLSPLQNIQNGFTALVNGVQISWVSYLILIVLLVLGVVLNLF
VRPEE
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atggaagggaaaataaaaaaaggtatcccttttgccttagcaattggagcaactttcttg
ttattactttttttcattcatttagggtttaaagatgagaacgtgactcgaagtagcaaa
gatcagacaacaaagatgcagtacgcattagttaatgaagataaaggcgcaagttttgaa
ggaaaacgttatgcattaggttctgattttgtcacattaattaacaaagatacagctaat
cgatgggaaacaacgactcggaatatcgcaacatctggggttgaaaatggacaattcgat
gctcaaattattattccgcaagatttttcggagaaattattgtcactacaagctgttagt
ccagagcaggcttctgttgaataccaagtgcgagacggacaaaatgaattgaccaatcaa
gcaattcaagacaaagtaaatactattttgaaagattttaaccaacgcgtaattcagatg
tatttttccagtattgttggaaatttagttatcgcacaacaaaacgttaaccaaattact
gatacgcagttgctgtatcaaaatcaattagaagaaacaattcagcaaccatttaaagaa
attcccatgaattatacgacagtattaagtacggctagtattttagatgaggacaataaa
ttatttacaaacgagcaagaagcgtttgtaaaatcagtacaaaccttattagaaagcaac
agtcggagcttagaatcaactagtaagacaacggaagatacgaaaaaatcagtggacgag
tattcgaaagaagcaaatgaaaaaataaaaaaatcaattgcacaatttaatgaacagttt
gagagacaaaaacaagaattgactaatcaatgggaaagtgacacgacagtatacaaacaa
caattcgatcaactaaatggaatggtaatcaatcagtttagctccttctacacaccaagt
gaacaaggaagctcagggatttatgctgactttttatcagaatctaaattatttcaagaa
acacaaggtaatcgcattggcgaactacaaaaagaaatcgcagaactacatatgcaagta
gaacaattaactgcgttaaaaaagcaaattgcggctacatattataatgatcttgaagca
acacctgagatagcaacagacactcaaattaagcaagcgattattcagttaattacgaac
gaaaaagaaaatatacctaacttagataaaaattatcaggaaagattggaagaatcacta
agtgaaatttcttttgtaagtttagaaagactcgttagtgaattagaaatgaataatagg
atttcagttgaacaaggcaatcttttccgtgatgagttacaaattattcagcgatatgca
gaacaacatgaacttgatttcaccaattcaagccgctttatgtatttggaacctaaacaa
cttcatgaagatactatagcgattccacaagaaaaagtaactttttcactagcgacaaat
caagagtcggttatttcattacgacaaaccaatacacaaaatggcgaattgtcatttctt
ttagatgattcaaaagttcaaacaattaaaacatctttgaatcagcagttagcaggtaca
ggttacagcattgatatttcagcaattaccccaacacagctaacaattaccaaaccagtc
aaaatacaagctgagattcctgagaatgatgaagtggacgaagaaaatacgcaagaagag
ttggcagaagaatccgaagatgaatctgaaaaagtaactgagccagtaaatgatttgctc
tcacttccagaaaaactttccttaacgattgacttaccaatgtcttggcaactgacacca
gaacaacaaaaaacagcatttaatcagattgattattcttggtgggtaaataatgagctt
caaaatgcacgttcgttcgctgtgtatattgcaatggaccaaccattagtaaccgatatt
cctgaaatcatgaagcaatttcaacttttagatactgtatcacaacaaattgtgacttta
tatggtacgcctaatcaaagtctatctattcaagagtatgcagcaatgttaaccgctcct
gaaaatcaggataaaacaattgaagagttagcaggtgagacatccatttactggatgtac
gacaatatcactgaaaacgagcaaaccatgatgattacagataaattattagacgaatat
aaaaaaacaggaaatcaattatatcgagaaacagatgaacaaattaatcaattaaaacaa
ttaattggtactgagacagatcaaaatacagacggacgacctacaacactttacggaaca
ttaaatttaatgacggtccctgaaaaattattacgagaagcggagaaattaaatacatgg
tttgatgaagcaacaaaacaagtcaatgcgacatatgctacttggcaagaagctggaaaa
gtgggagctacttctgtaattgatgaaagaaatccacatccagaagaaagtcaaaccagc
actttagatgtagaaacagaaaatttagttaaaatgatgcaaacgttaatgcaaacaacg
aaagaaactagtctaacaacagctgattcagcagccaaagtcaaagatgttgcccagact
atcaaagaattgaaagcctcaacaaccaaagttcaagatcatgcgcaaaatatcttagca
aacttaaatgattcaattgatgagtcaaagaaaacaaccaaagaaaatgaagagtatgcc
aaaacatttgaaaaagtattggctaatacaagagacggcggtgctgataatccacgggta
tttagtttccttgcgagcccaattcaaggagaagggatctttggcgaaacccgacaagtc
tctttaattccctattacgctaccttgattgttagtattttgacattcgttattgcgcta
actttccaaggctttatgaagaaaagaacagttactgtagcggatgcgttggttgaacca
accagagtttggcaaaatataccaaatctgttattactcttgattacggttattttgttt
gggagtgtcttttcacttctactggtgttcaatgtatctcaaataaatcgattcgcttgg
tttagctatagtttcttagtatttgctagcggtgcacttttggtttgtgcttgtttacgc
caatttaaaaaacttactttatatgtttatggagctatgctggggttatttttcatgttg
acacctttattaggtattgcaacaaaggtaggctcattaagcaattggctctatcgttta
tcgccgcttcaaaatatccaaaatggctttactgctttagtaaatggcgtacaaattagt
tgggttagttaccttattttaatcgttttacttgttttaggtgttgtccttaatttattt
gtacgaccggaggaatag

DBGET integrated database retrieval system