KEGG   Enterococcus faecium DO: HMPREF0351_11452Help
Entry
HMPREF0351_11452  CDS       T02120                                 

Gene name
ahpF
Definition
(RefSeq) peroxiredoxin subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
efu  Enterococcus faecium DO
Brite
KEGG Orthology (KO) [BR:efu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HMPREF0351_11452 (ahpF)
Enzymes [BR:efu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HMPREF0351_11452 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C FMO-like Thi4 K_oxygenase DAO FAD_binding_3 Glutaredoxin Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 13000142
NCBI-ProteinID: YP_006376058
UniProt: I3U238
LinkDB All DBs
Position
1439675..1441213
Genome map
AA seq 512 aa AA seqDB search
MVDMLDKETKQNLEQYLALIESPIVFSVSLDNSENSQKLAEFTKEIAEMSPKISWEKRDS
MRTPSFSINPVGKESGIVFAGIPLGHEFSSFLLAMLQISGRAPKISESLSLKIKKITQTL
HFDSYVSLTCHNCPDVVQALNILAVLNPNITHTMIEGGMFQKEIDDKKIMAVPTVFLNGE
EFSSGRMTIEQIVEKITGPLIEEELFEKEPYDVLVIGGGPAASSAAIYAARKGIRTGLVA
DSFGGQVVETLGIENMIGTSYTEGPKLMQQVESHVRSYPIDIMMNQQAVSLNKEQHFINI
GLANGISLKAKTAIIATGAHWRSINVPGEKEFKNKGIAYCPHCDGPLFKGKEIAVIGGGN
SGVEAAIDLAGLAKHVYVLEFLPELKADQILQDKLVSLANVTVIKHAATKEISGTNQVES
LSYIDRRTMEMHTLAVSGVFILVGLLPNTDWLDGTIEMNPRNEIVTEKNGATNIPGVFAA
GDCTDSPYKQIIVSMGSGATAALGAFDYLMRT
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtggtggatatgttagacaaagaaactaaacaaaatctcgaacaatatttagcactgatt
gaatctcctattgttttttctgttagtttggataatagtgaaaatagtcaaaaactagct
gaatttacgaaggaaatagcagaaatgtctcctaaaatctcttgggaaaaaagagattcg
atgcgcacacctagtttttctatcaatccagttggcaaagaaagtggaatcgtttttgct
ggtatccccctcggtcatgaattttcctcttttttactggctatgttacaaattagtgga
cgggcaccgaaaatcagtgaatctttgagtcttaaaatcaaaaaaataacacaaacattg
cattttgacagttatgttagcttgacttgtcataattgccccgacgttgtacaggcattg
aatatattagctgtattaaatccaaatattactcatacgatgattgaaggtgggatgttc
caaaaagaaatcgatgataaaaaaatcatggcagtgccaactgtgtttttaaatggagaa
gaatttagtagcggacgcatgacgatcgaacaaattgttgaaaaaatcactggccctttg
attgaagaagagttgtttgaaaaagaaccttatgatgtattagtgattggcggtggacca
gcagctagtagtgcagctatctatgcagcacgtaaaggaatccgtacaggacttgtcgct
gattctttcggcggacaagtcgttgaaacactagggattgaaaatatgattggtacctct
tacacagaaggtccaaaattgatgcagcaagtagaaagtcatgtgcgtagttaccctatc
gacattatgatgaatcaacaggccgtttccttaaataaagagcaacattttattaatatt
ggcttagctaacggtatatcacttaaagcaaaaaccgccatcatcgcgacaggtgcgcac
tggcgttctatcaatgtaccaggcgaaaaagagtttaaaaataaaggaattgcttattgc
ccacactgtgacggccctttatttaaaggaaaagagattgctgttatcggtggtggtaat
tctggtgttgaagcagcaatcgatttggctgggttagcaaaacatgtatatgttctagaa
ttcttaccagaattaaaagcagatcaaatcttacaggataaactagtctctcttgcgaat
gtcactgttatcaaacatgcagcgacgaaagaaatcagcggtacgaatcaggtagaatct
ctctcctatatcgatcgccgtacgatggagatgcatacactagctgtttcaggagtattc
attctagtcggcttactccctaatacggattggctagatggaacgatcgaaatgaatcca
agaaatgaaatagtgaccgagaaaaatggcgcaacgaatatccccggtgttttcgcagct
ggtgattgtacagatagtccatacaaacaaatcattgtttcaatgggttcaggagctact
gcagctttaggagcattcgattatctgatgcgcacttga

DBGET integrated database retrieval system