KEGG   Erythrobacter flavus: CHH26_02640Help
Entry
CHH26_02640       CDS       T04986                                 

Definition
(GenBank) transcriptional regulator
Organism
efv  Erythrobacter flavus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR_2 MarR HTH_24 TrmB HTH_27 HTH_20 HTH_IclR HTH_5 TFIIE_alpha HTH_AsnC-type HTH_11 HTH_Crp_2 RP-C Mga HTH_29 Fe_dep_repress B-block_TFIIIC GntR HTH_36
Motif
Other DBs
NCBI-ProteinID: ASP29260
UniProt: A0A222ERU1
LinkDB All DBs
Position
528857..529333
Genome map
AA seq 158 aa AA seqDB search
MAATTDYDTDTKGASFLTDTDRLFFLMEEVTRRLRRTFDSSVEQFGLTRTQWRILAYLFR
SPGMTQTELARELELERASIGRTIDRLEELELVERRSAKNDRRVWRVHLRPAAIELLPKM
RVEADAMYARLLGGIRFGELERLRGSLARMHDNLASEP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggctgccacgacggactatgacacggatacaaagggggcaagtttcctcaccgatacc
gatcggctgttctttcttatggaggaagtgacgcggcgtttgcgcaggacctttgattct
tcggttgaacaattcgggctcacgcggacgcaatggcgtattttggcttatctctttcgg
agcccaggcatgacccagaccgagctggctcgggaactggagttagagcgcgctagcatc
ggccggactattgatcgcctggaagaacttgagctggtggaaagacgcagcgcgaagaac
gacaggcgcgtttggcgggttcatttacgccctgccgcaatcgagctacttcccaagatg
cgagtagaagctgatgcaatgtatgctcgcttgctcggggggatccgttttggggaactg
gagcgcttacgcggatcgctggccaggatgcatgacaatctggccagcgagccataa

DBGET integrated database retrieval system