KEGG   Erythrobacter flavus: CHH26_11405Help
Entry
CHH26_11405       CDS       T04986                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
efv  Erythrobacter flavus
Pathway
efv00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:efv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CHH26_11405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:efv02000]
    CHH26_11405
Enzymes [BR:efv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CHH26_11405
Transporters [BR:efv02000]
 Other Transporters
  Pores ion channels [TC:1]
   CHH26_11405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ASP30765
UniProt: A0A222EVF5
LinkDB All DBs
Position
2284972..2285607
Genome map
AA seq 211 aa AA seqDB search
MADYTFYTNPMSRGQIVRWALHEAQADYEQVLLTYGGTIAEPAYLAINPMGKVPALVHHR
AGGDRIITECAAICHYLAETAAPALLAHDAEKSEYFRLPFFAAGPLEQAITARNMGWDPA
EPEKQATTGFGSYERTVDAFETLLQGRDFVCGERFTMADVYVGSQVIWGVQFGTLPKRDA
FEAYASRLTERTAYIEAKAIDAKLIEENANG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcggactacaccttctacaccaaccccatgagccgcgggcagatcgtccgctgggcg
ctgcacgaagcgcaggcggattacgagcaggtcctgctgacctatggcggcaccattgcc
gagcccgcctatctggcgatcaacccgatggggaaggtcccggcactggtccaccaccgt
gcgggcggcgaccggatcatcaccgaatgcgcagcgatctgtcactacttggccgaaacc
gcagcgcccgcgctgctcgcgcacgatgccgagaagtccgagtatttccgcctgccgttc
ttcgcagcgggaccgctggaacaggccataaccgcgcgcaacatgggatgggatccggca
gaacctgaaaagcaggcgacgaccggcttcggcagctacgagcgaacggtcgatgcgttc
gaaacgctgctgcaaggccgtgacttcgtgtgcggcgaacgcttcacgatggccgatgtt
tacgtcggcagccaggtaatctggggcgtccagttcgggaccctgcccaagcgtgacgct
ttcgaagcctatgcctcgcggcttaccgaacgcaccgcctatatcgaggccaaggcgatc
gatgccaagctgatcgaggagaatgcaaatggctga

DBGET integrated database retrieval system