KEGG   Erythrobacter flavus: CHH26_12220Help
Entry
CHH26_12220       CDS       T04986                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
efv  Erythrobacter flavus
Pathway
efv00473  D-Alanine metabolism
efv00550  Peptidoglycan biosynthesis
efv01100  Metabolic pathways
efv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:efv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CHH26_12220
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CHH26_12220
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CHH26_12220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:efv01011]
    CHH26_12220
Enzymes [BR:efv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CHH26_12220
Peptidoglycan biosynthesis and degradation proteins [BR:efv01011]
 Precursor biosynthesis
  Amino acid ligase
   CHH26_12220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 B12-binding
Motif
Other DBs
NCBI-ProteinID: ASP30909
UniProt: A0A222EWM6
LinkDB All DBs
Position
complement(2440785..2441759)
Genome map
AA seq 324 aa AA seqDB search
MSDLPKLHIAVLMGGWANERPVSLMSGEGVAKALEARGHRVTRIDMDRQVAARIAEAAPD
VVFNALHGVPGEDGTVQGMLDLMGVPYTHSGLATSVIAIDKQLTKQALVPQGIPMPGGRT
VKSAELFERDPLPRPYVLKPVNEGSSVGVAIVTEDGNYGNPIARDASGPWQDFGELLAEP
FIKGREMTTAVVDFADGPRALAVTELKPKSGFYDFDAKYTDGMTDHVCPAQVPETIADLC
REYALRAHRVLGCRGTSRTDFRWDEEQGEDGLFVLETNTQPGMTPLSLVPEQARYAGLDY
GELCELVVAAALRDHAPKPGTGDG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccttcccaaactccatatcgccgtgttgatgggcggctgggccaatgaacgg
ccggtcagcctgatgtcgggcgaaggcgtcgccaaggcgctcgaggcgcgcggccatcgc
gtgacgcggatcgacatggaccggcaggtcgccgcgcgcattgccgaagcggcgcccgat
gtcgtattcaacgcgctccacggcgtcccgggcgaggacggtacggtgcaggggatgctc
gacctgatgggcgttccctatacgcattcgggcctcgcgacttcggtgatcgcgatcgac
aagcagctgaccaagcaggcgctggtgccgcaggggattcccatgccgggcgggcggacc
gtcaagagcgccgaactgttcgaacgtgatccgctgccgcgcccctacgtcctgaaaccg
gtcaacgagggcagttcggtcggcgtggcgatcgtcaccgaggatggcaattacggcaac
ccgatcgcgcgcgacgccagcggaccgtggcaggatttcggcgaactgctggcggaaccc
ttcatcaagggccgcgagatgaccacggcagtcgtcgatttcgctgatggtccgcgtgcg
ctcgcggtgaccgagctcaagcccaagagcgggttctatgatttcgatgcgaaatatacc
gacgggatgaccgatcacgtctgcccggcgcaggttcctgaaaccatcgccgatctgtgc
cgcgaatatgcgctcagggcacatcgtgtgctcggctgccgcggaaccagccgtaccgat
ttccggtgggatgaagagcagggcgaggacggtctgttcgtgctcgaaaccaacacgcag
ccgggcatgacgccgctcagcctcgtgcctgaacaggcgcgctacgccggtctcgactat
ggagaattgtgcgaactggtggtggccgcggcattgcgcgaccacgcgccgaaaccggga
acgggcgatggctaa

DBGET integrated database retrieval system