KEGG   Erythrobacter flavus: CHH26_15010Help
Entry
CHH26_15010       CDS       T04986                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
efv  Erythrobacter flavus
Brite
KEGG Orthology (KO) [BR:efv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CHH26_15010
Enzymes [BR:efv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CHH26_15010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like K_oxygenase FAD_oxidored DAO NAD_binding_8 FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-ProteinID: ASP31397
UniProt: A0A222EXG7
LinkDB All DBs
Position
3045826..3047415
Genome map
AA seq 529 aa AA seqDB search
MLDATMAQQLKTYLANLREPVELVASLGDDDKSTQTRELLEEIAALHDLVSASFDGTDAR
KPSFIIRRGSDAEKWVRFAGLPMGHEFTSLVLALLWAGGHPPKVDADLLEQVRGLEGDFN
FEMYFSLSCHNCPDVVQALTLLALENSRVTATLIEGGTFQDEVEARDVMAVPATFLNGEP
FYNGKLELAEILAKIDTASEAKAAEKLAAKDPFEVLVIGGGPAGAATAIYTARKGFRTGV
AAERFGGQLHDTLGIENLPGTPYTEGPKLAGELKRHVGEYDIDLMDLAKAVKLVPAKQEG
GLHTVELGNGASLKARSLILATGARWRNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
IGGGNSGVEAAIDLAGVVGHVTLIEFDSKLRADEVLQAKLRSMANVEIITNGQTTEILGA
EGKVNGLRLKDRESGEERTIELEGVFVQIGLVPNTEWLEESGLELTKHGEIATDEEGRTN
LPGVFGAGDVTDVPYKQIVVAMGEGSKAGLSAFDYLIRTEPADEIAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcaaccatggcccagcaattgaagacctatctcgccaacctgcgcgaaccg
gtcgaactggtcgcctcgctcggcgatgacgacaagagcacccagacccgtgagctgctc
gaagagattgccgcgctgcacgatctcgtcagcgccagcttcgacggcaccgacgcgcgc
aagcccagcttcatcatccgccgcggtagcgatgcggaaaagtgggtgcgtttcgcaggc
cttccgatgggtcacgaattcacctcgctggtgctcgctcttttgtgggccggtggacac
ccgcccaaggtcgatgcggacctgctcgaacaggttcgcgggctcgaaggcgatttcaac
ttcgagatgtatttttcgctttcgtgtcacaattgtccggacgtggtgcaggctctcact
ctgctggcgcttgaaaattcgcgcgtcacggccacgctgatcgaaggcggcaccttccag
gacgaagtcgaagcgcgcgacgtgatggcggtccccgcgaccttcctcaacggcgagccc
ttctacaacggcaagctcgaactggccgaaatcctcgccaagatcgacactgccagcgaa
gccaaggcagccgagaagctagccgccaaggaccccttcgaagtgctggtgatcggcggt
ggtcccgccggtgcggcaactgcgatctacaccgcgcgaaagggctttcgcaccggcgtg
gcggcggaacgtttcggcggccagttgcacgacacgctgggcatcgagaacctccccggc
acgccctacaccgaaggtcccaagctggcgggcgaactgaaacgccacgtgggcgaatac
gacatagacctgatggatctcgccaaggcggtgaagctggtgcccgccaagcaggaaggc
ggcctgcacacggtcgagcttggcaatggcgccagcctcaaggcacgcagcctgatcctg
gccaccggtgcccgctggcgcaatctcggtgtccctggcgaagccgaatatcgcaacaag
ggcgttgcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcatcgcagtg
atcggcggcggcaattcgggtgtcgaagcggctatcgacctcgccggtgtcgtcggccac
gtcacgctgatcgaattcgacagcaaattgcgggcggacgaagtgctgcaggccaaattg
cgctcgatggccaatgtcgaaatcattaccaatggccagaccaccgaaatcctcggtgcc
gagggcaaggtcaacggcctgcgtctgaaggaccgcgagagcggcgaggagcgcacgatc
gaactcgaaggcgtattcgtccagatcggcctggtgcccaacaccgaatggctcgaggaa
agcggtctcgaactgaccaagcacggcgaaatcgccaccgacgaggaaggccgcaccaat
cttccgggcgtgttcggcgcaggcgatgttaccgatgtgccctacaagcagatcgtggtg
gcaatgggcgaaggctcgaaggccgggctttccgcattcgattatctcatccgcaccgaa
cctgccgatgagatcgcgcaagccgcctga

DBGET integrated database retrieval system