KEGG   Enterococcus gallinarum: AL523_03895Help
Entry
AL523_03895       CDS       T04148                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ega  Enterococcus gallinarum
Pathway
ega00250  Alanine, aspartate and glutamate metabolism
ega00430  Taurine and hypotaurine metabolism
ega00650  Butanoate metabolism
ega01100  Metabolic pathways
ega01110  Biosynthesis of secondary metabolites
ega01120  Microbial metabolism in diverse environments
ega02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ega00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AL523_03895
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL523_03895
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AL523_03895
   00430 Taurine and hypotaurine metabolism
    AL523_03895
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AL523_03895
Enzymes [BR:ega01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AL523_03895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AMG48961
UniProt: A0A0X8PMT1
LinkDB All DBs
Position
complement(811173..812567)
Genome map
AA seq 464 aa AA seqDB search
MLFSKKNRKEAQYLEPIYGNEAMDQAIPMYKLPKESLVPRDAYELVKDQLIDEGVSRQNL
ATFCQTYMEPEAVKIMSETLDKNAIDKTEYPRTAEIENRCVNMIADLWHAPEASDFIGTS
TVGSSEACMLGGLALKFAWRNRAKKLGLDINKQKPNLVISSAYQVVWEKFCVYWDIEMRT
IPIDEEHGSINVEKVTDYLDEYTIGVVGILGITYTGRYDDIKALDKKLEEYNKHTDYKVY
IHVDAASGGLYTPFMEPELEWDFRLKNVRSISTSGHKYGLVYPGIGWVLWKEKDFLPEEL
VFKVSYLGGEMPTMAINFSRSASQIIGQYYTFIRNGFEGYRLIHKKTSDVAQYLAKEIEN
MGYFDIYNDGSRLPIVCYKLKEDADISWNLYDLTDEFAMKGWQVPTYPLPDNLSHINIQR
FVCRADLSMQMAMDLVQDMKEGIERLNKRPSRHVSSDQTYGFSH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatttagtaaaaaaaatcgaaaagaagcccaatatttggagcctatctatgggaat
gaggcaatggatcaagcgatccctatgtacaaattaccaaaagagtccttggtaccgcgg
gatgcctatgaattagtcaaagatcaattgatcgatgaaggggtctcaagacaaaatttg
gcgacgttctgtcaaacctacatggaaccagaagcagtcaaaattatgagtgaaaccctt
gataaaaacgccatcgataaaaccgagtacccacggacagcagaaattgaaaaccgctgt
gtcaatatgatcgctgatttatggcatgccccagaagcgtccgattttatcggtacatca
acggtaggctcaagtgaagcgtgtatgttaggtggattggccttaaaatttgcttggcgc
aatcgggcaaaaaaacttggcttagatatcaataaacaaaaaccaaacttagtgatttct
tctgcctatcaagtcgtttgggaaaaattctgtgtctactgggacattgaaatgcgaacg
atccctatcgatgaagaacatggcagcattaatgttgaaaaggtcacggactatttagat
gaatatacgatcggggtcgttggtattttaggaatcacttacactggacgatacgatgat
atcaaagcactagacaagaaattagaggaatacaacaaacacaccgactacaaagtctac
atccacgtggatgcggctagtgggggattgtacacgccatttatggaaccagaacttgaa
tgggatttccgtttgaaaaacgttcgttccatcagtacgtctggacataaatatgggtta
gtctaccctggtatcggttgggtgctttggaaagaaaaagatttcttaccagaagagttg
gtctttaaagtaagttatcttggcggtgaaatgccaacgatggccatcaacttttcaaga
agcgccagccaaatcatcggacaatattacacctttatccgcaatgggtttgaaggctac
cgcttgatccacaaaaagaccagcgatgttgcccaatatttagcaaaagagattgaaaac
atgggttacttcgatatttataatgatggttcacggttgccgatcgtctgctacaaatta
aaagaagatgccgatatttcttggaatctgtatgatttgacggatgaatttgcgatgaaa
ggttggcaagtccctacctatccattacctgataatctatcacatatcaatatccaacgc
tttgtctgccgggcagatttaagtatgcaaatggcaatggatctggtgcaagacatgaaa
gaaggaatcgagcgcttgaacaagcgaccaagccgtcatgtttcatccgatcaaacctat
ggcttttcacattaa

DBGET integrated database retrieval system