KEGG   Enterococcus gallinarum: AL523_06060Help
Entry
AL523_06060       CDS       T04148                                 

Definition
(GenBank) sugar phosphate isomerase/epimerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
ega  Enterococcus gallinarum
Pathway
ega00040  Pentose and glucuronate interconversions
ega00051  Fructose and mannose metabolism
ega01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ega00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AL523_06060
   00051 Fructose and mannose metabolism
    AL523_06060
Enzymes [BR:ega01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     AL523_06060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AMG49355
UniProt: A0A109Y4I3
LinkDB All DBs
Position
1279085..1280029
Genome map
AA seq 314 aa AA seqDB search
MKLATRINSFLSIYENDLDNVFGAFKELGLDYVDLNYPEHVGGTTASEMKERLGQADLKL
NGVALRFREEFINGELGNADPQVAQHALTLCKEAADYCRAAGGEVVTIWLGFDGFDYSFQ
INYQKVWNQIRDAFIEIADYAPDLKISIEYKPFQPRAYAFIDSMGVTGMMLNEINRKNVG
VTLDYCHMLMKHENPAFAADLFAGKGLLYGVHLNDGYGLNDDGLMIGSATPFKTLEFLYY
VKKHNYDGVIYFDTFPVIEHASKECEQNMKMIKQMDQMIDNVGLAAIQAVIDQNDAVAAN
QLLLEFLSPTNQSK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcaacgagaatcaattcatttttatcaatttacgaaaatgatttagacaat
gtatttggcgcattcaaagaattggggcttgattacgtagatttaaattatccggagcac
gtcggtgggacgactgcctctgaaatgaaagagagattgggacaagctgatttgaaattg
aatggtgttgcattgcgattcagagaagagtttatcaacggtgaattaggcaatgctgac
ccacaggttgcgcagcatgccttgacattatgcaaagaagctgctgattattgtcgtgca
gcaggtggagaagtcgtaaccatttggctcggttttgatggctttgactatagttttcaa
atcaattaccaaaaggtttggaatcagattcgggatgcttttattgaaattgctgactac
gcaccagatttgaaaatcagtatcgagtataaaccatttcaaccaagagcctatgcgttc
attgatagtatgggtgtcactggaatgatgcttaatgagatcaaccgcaaaaatgtaggt
gtgacccttgattattgccacatgctaatgaaacacgaaaaccctgcttttgctgcggat
ctgtttgctggaaaagggttattatacggggtgcatctgaatgatgggtatgggttaaac
gacgatggattgatgatcggttcagcaacacccttcaaaacattagaattcttgtattat
gtcaaaaagcataactatgacggtgtgatttattttgatacgttccctgtaattgaacat
gcctcaaaagagtgcgaacaaaacatgaaaatgatcaaacaaatggatcaaatgatcgat
aacgtaggcttggctgcgattcaagctgtgatcgatcaaaacgatgcagtcgcagccaat
cagttgctgcttgaatttttgtcaccaacaaatcaatcaaaataa

DBGET integrated database retrieval system