KEGG   Enterococcus gallinarum: AL523_08085Help
Entry
AL523_08085       CDS       T04148                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ega  Enterococcus gallinarum
Pathway
ega00040  Pentose and glucuronate interconversions
ega00051  Fructose and mannose metabolism
ega01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ega00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AL523_08085
   00051 Fructose and mannose metabolism
    AL523_08085
Enzymes [BR:ega01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     AL523_08085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AMG51445
UniProt: A0A0X8PSU7
LinkDB All DBs
Position
1719340..1720374
Genome map
AA seq 344 aa AA seqDB search
MKAAVLKGPETIEVKQVPVPKVEEGLIEIQVSACGVCGSDVHMWQAGKGWGKTGESDFIM
GHEFCGVVKDAGDSSFKIGDRVAFWANLYCGKCEMCQKGQEHLCREVNGTNYIGFVCNGA
YAERFVGKASNAYKLPDTVSDTAASLIDPLMVAYHAIRKSNIKLNDKVLVSGSGIIGQLI
GELAKKAGASYVAMSKINDTKIEKAKELGIFDDYFDAKDSNRGEVLKDASAGGFDLIFEA
VGSSSSLATCIEAARPGATIVAIGNSVAPEIPFSLNRLVLQEIKLIGSVSCTRQEFEETI
DLIASGMIDPTKYITDEYPLEKLQEALERQTLEDDPLVKAVMRF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtattaaaaggaccagaaacgatcgaggtcaaacaagtacctgtgccg
aaagtggaagaaggactgatcgagatccaagtttcagcgtgcggcgtctgcggcagtgac
gtgcatatgtggcaagcagggaaaggttggggcaaaacaggggagtccgattttatcatg
ggtcacgagttttgcggtgtcgtgaaggatgcaggcgatagttcctttaaaatcggcgat
cgcgtcgctttttgggcaaatctttattgtggaaaatgtgagatgtgccaaaaagggcaa
gagcatttgtgtcgggaagtaaacggcaccaattatatcggctttgtctgcaatggcgcc
tatgccgaacggtttgtcggaaaagcgtccaatgcttataaattgccagatacagtttca
gatacagcagctagcttgattgatcccttgatggttgcctatcatgccatccgtaaatcc
aatattaagttaaatgacaaagtcttggtttctggaagtgggatcatcgggcaattgatt
ggcgaattggcaaaaaaagctggggcttcttatgtggccatgtccaaaatcaacgataca
aaaattgagaaagccaaggaattgggaatctttgacgattactttgacgctaaggattca
aaccgcggggaagtattgaaagacgcgtctgctggtgggttcgatttgatttttgaagcg
gtcggttccagcagttccttagcgacatgcattgaggctgctcgtcctggcgcaacgatc
gtggcgatcggaaattccgttgctcccgaaattcctttttcattaaatcggttggtcttg
caagaaatcaagctcattggcagcgtttcatgcacccgccaagagtttgaagaaacgatc
gatttgattgctagtggcatgatcgatcccacaaaatatatcacggatgaatacccattg
gaaaaactgcaagaggcgctagaacgccaaacgttagaagatgatccgttggtcaaagcg
gttatgaggttttaa

DBGET integrated database retrieval system