KEGG   Enterococcus gallinarum: AL523_12650Help
Entry
AL523_12650       CDS       T04148                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ega  Enterococcus gallinarum
Brite
KEGG Orthology (KO) [BR:ega00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AL523_12650
Enzymes [BR:ega01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AL523_12650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO AlaDh_PNT_C Thi4 FAD_binding_3 Thioredoxin_4 FMO-like Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AMG50538
UniProt: A0A109Y5L0
LinkDB All DBs
Position
2728775..2730304
Genome map
AA seq 509 aa AA seqDB search
MALDKAIKDQLTQYLAMLESEVVFAATLGEDDSSTKVREFLEEIAEMSSKITIQAVASER
TPSFSINRPGEESGIAFAGLPLGHEFTSFILALLQVSGRPPKIDEALQKRIKAIDKPLHF
ETYVSLTCHNCPDVVQALNIMAVLNPSISHTMIEGGMFKEEIDKKKIMAVPTVFLDGEEF
ASGRQTIEQLLEKAAGPTSKDDFAEKELFDVLVVGGGPAGGSAAIYAARKGINTGMVVET
MGGQVMETLGIENMIGTPYTEGPKLMRQVEEHINEYKVDVMKGQRAKDIRRNDVIEVELE
NGAVLKTKTAILATGARWRNINVPGEKEFKNKGVAYCPHCDGPLFAGKEVAVIGGGNSGI
EAAIDLAGMAKHVYVLEFLPELKADLVLQNRLNTLENVTVITNAATKEIAGSDHVEQLTY
VDRETNGEFTLAVEGVFILIGLMPNTEWLKDRIVLNERNEIVVDKHGATNIEGVFAAGDC
TDSVYKQIITSMGSGATAALGAFDYLIRS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcattagataaggcaatcaaagaccaactgacgcaatatctagcgatgctagaatca
gaggttgtttttgcggcgactttaggtgaggatgattcttcaacgaaagtacgtgaattc
ttagaagaaatcgcagaaatgtcgtcaaaaatcacgattcaagctgtagcaagtgaacgg
acaccaagcttttcgatcaatcgtcccggtgaagaaagcggcatcgcttttgctggttta
ccgttaggacatgagttcacttcatttattttagcgttgcttcaagtaagcggtcgtccg
ccgaaaattgacgaagcactacaaaagcgtatcaaagcgatcgataagccattacatttt
gaaacctatgtcagtttgacctgccataactgtcctgatgttgttcaagcgttaaatatc
atggcagtgctaaatccttccatcagccacaccatgatcgaaggtgggatgttcaaagaa
gaaattgacaagaaaaaaattatggctgtgccaacagtctttctagatggggaagaattt
gcaagcggccgtcaaacgatcgaacaattattggaaaaagcagctggtccaacgagtaaa
gatgattttgctgaaaaagagcttttcgatgttttggtcgtcggtggcggacctgcaggt
ggaagtgcagcgatttatgcagcgcgtaaaggtatcaatactgggatggttgtcgaaaca
atgggtggccaagtgatggaaacccttggtatcgaaaacatgatcggtactccttatacc
gaaggaccaaaattaatgcgtcaggtagaagagcacatcaacgaatataaagtcgatgtc
atgaaagggcagcgtgccaaggatattcgtcgcaatgatgtcatcgaagttgaattagaa
aatggcgcagtattaaaaaccaaaacggctattttagcaaccggtgctcgctggcgcaac
atcaatgttccgggagaaaaagaattcaaaaataaaggtgttgcctattgtccacattgt
gacggcccgttatttgctgggaaagaggttgctgtcattggcggcggaaactctgggatc
gaagcagcgatcgatttagctggcatggcaaaacatgtctacgttcttgaatttttacca
gaactaaaagcggaccttgtgctacaaaaccgtttgaacacgttagaaaatgtgactgtt
attacgaatgccgcaacgaaggaaattgctggatccgatcatgtcgaacaattgacctac
gttgatcgcgaaacgaatggcgaattcacattagctgtggagggtgtcttcattttgatt
ggcttaatgccgaatactgaatggttaaaagaccgcatcgttttaaacgagcgtaatgag
atcgtggtagacaaacatggagcaaccaacattgaaggcgtctttgcagcgggagattgt
accgatagtgtatacaaacagatcatcacttcaatgggttcaggtgctactgctgcgtta
ggtgcgtttgattacctgattcgctcgtaa

DBGET integrated database retrieval system