KEGG   Enterococcus gallinarum: AL523_13285Help
Entry
AL523_13285       CDS       T04148                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ega  Enterococcus gallinarum
Pathway
ega00030  Pentose phosphate pathway
ega01100  Metabolic pathways
ega01110  Biosynthesis of secondary metabolites
ega01120  Microbial metabolism in diverse environments
ega01130  Biosynthesis of antibiotics
ega01200  Carbon metabolism
ega01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ega00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AL523_13285 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    AL523_13285 (tkt)
Enzymes [BR:ega01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     AL523_13285 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AMG50653
UniProt: A0A0X8PR75
LinkDB All DBs
Position
2846290..2848287
Genome map
AA seq 665 aa AA seqDB search
MFDKIDQLGVNTLRTLSIEAVQKANSGHPGLPMGAAPMAYALWTKHLKVNPTTSRNWVDR
DRFVLSAGHGSALLYSLLHVSGYDVTIEDLKNFRQWDSRTPGHPEVDHTDGVEATTGPLG
QGIAMAVGMAMAEAHLAATYNRDKYQVIDHYTYALCGDGDLMEGVSQEAASMAGHMKLDK
LIVLYDSNDISLDGPTSKAFTENVGARFEAYGWQHILVEDGNDLEAISKAIDEAKAESDK
PTLIEIKTVIGYGAPNQGTSAVHGAPIGAEGISAAKAIYGWEYPEFTVPEEVAARFKETM
IDEGQKAEAAWNETFHAYEAAYPELAAQFKQAFAGELPADWDAALPSYEVGSSQASRVSS
KEMIQALSKAVPSLWGGSADLSGSNNTMVAAEKDFEPGQYEGRNIWFGVREFAMAAAMNG
IQLHGGTRIYGGTFFVFVDYLRPAVRLSAIQHAPVIYVLTHDSVAVGEDGPTHEPIEQLA
SVRCMPNVQVIRPADGNETRAAWKLAMTTTDKPTVLVLSRQNLPVIEGTQTGADENVAKG
GYVISKQAGETPAGILIATGSEVNLAVQAQAKLAEEGIDVSVVSLPSFDLFEAQSSEYKE
SVLPKAVKKRVAIEAASPFGWERYTGCHGKVIAIDHFGASAPGDKVLAEFGFSVENVVNT
FKSID
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgataaaatcgatcaattaggagtgaacacccttcgtacattaagtatcgaagcc
gtacaaaaagccaattcaggacatccaggattaccgatgggggcagcacccatggcctat
gccttgtggaccaaacacttgaaagtcaatccaacgacttctcgcaactgggtggatcgt
gaccgctttgttttgtctgctggacacggttcggcgctattgtacagcttgttgcatgtg
tctggttacgatgtgaccattgaggatctaaaaaacttccgtcaatgggatagccgcacg
ccaggacatccagaagtcgatcacacagacggcgtggaagcaaccactggacctttagga
caagggatcgctatggcagtcggtatggcaatggccgaagcccacttggctgcaacctac
aatcgcgacaagtatcaagtcatcgatcactatacctatgccttatgtggcgatggggat
ttgatggaaggtgtttcgcaagaagctgcatccatggcgggtcacatgaaattagataaa
ctgatcgtcttgtacgattcaaacgacatttccctagatggtccgacctcaaaagccttt
acagaaaatgtcggtgcgcgttttgaggcgtatggctggcaacacattctcgttgaagac
ggcaatgatttagaagcaatctcaaaagcgatcgacgaagcaaaagctgaaagcgacaaa
ccaaccttgatcgaaatcaagactgtgatcggatacggtgcgccaaatcaaggcacctct
gccgttcatggtgcgccgatcggtgccgaaggcatttctgcagctaaagcgatttatggc
tgggaatacccagaatttaccgtacctgaagaagttgccgcgcgcttcaaagaaaccatg
atcgatgaaggacaaaaagctgaagccgcttggaacgaaactttccatgcctatgaagca
gcctacccagaacttgcggcgcaattcaaacaagcctttgcgggtgaattgccagcagat
tgggatgcagcattaccaagctacgaagttggcagctcacaagctagtcgagtatccagc
aaagagatgatccaagccttatccaaagccgtccctagtctctggggtggatcggctgac
ctttctggctccaacaacacgatggtggcagcagaaaaagactttgaacctggccaatac
gaaggccgcaacatttggtttggtgtccgagaatttgcgatggcggcagcgatgaacgga
atccaattgcatggcggtacgcgaatctatggcggaaccttcttcgtcttcgttgattac
ttgcgtccagcggtgcgcttgtctgcgatccagcatgcacctgtgatctatgtcttgacg
catgactccgtggcggtgggagaagatggaccgacgcatgagccaatcgagcaattagcc
agcgtccggtgcatgccaaatgtccaagtgattcgtccagcagacggcaatgaaacccgt
gctgcctggaaattggccatgacgacaacggataaaccaacggtcttagtcttaagccga
caaaatctaccagtgatcgaaggcacgcaaaccggtgcggatgaaaatgtcgcaaaaggt
ggctacgtgatttcaaaacaagctggtgaaacaccagcggggattttgatcgccacaggt
tctgaagtgaatcttgcggttcaagcacaagctaaattggcagaagaaggcatcgatgta
tcggtggtctccttaccaagctttgatctgtttgaagcgcaaagctcagaatacaaagaa
agcgtcttgccaaaagcagtgaagaaacgggtagcgattgaagcggcttccccatttggt
tgggaacgttacaccggttgccatggaaaagtgatcgcgatcgatcacttcggtgcatca
gcacctggcgacaaagtattagcagaattcggctttagtgttgaaaatgttgtgaatact
tttaaatcaatcgattaa

DBGET integrated database retrieval system