KEGG   Enterococcus gallinarum: AL523_14870Help
Entry
AL523_14870       CDS       T04148                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ega  Enterococcus gallinarum
Pathway
ega00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ega00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AL523_14870
Enzymes [BR:ega01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AL523_14870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_14 Glyco_hydro_42C Cellulase Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: AMG50947
UniProt: A0A109Y5W2
LinkDB All DBs
Position
complement(3174891..3176903)
Genome map
AA seq 670 aa AA seqDB search
MTKFFDRILFGGDYNPNQWPKEIWEEDIRIFKKASINSATVNVFSWAKIQPSENCYDFEE
LDQIIEKLSTEGFDIVLATSTAALPAWMFKKYPEVARTDYDGRHHKFGQRHNACPNSLVY
QKYAERLATKLAERYGENPQVTCWHINNEYGGECYCENCEKAFRVWLKDKYQTIEALNKA
WNMEFWGHTVYEWDEIVLPNALSEGIGYDKTAFAGISIDYRRFNSDSLLKNYMMERDAIR
KIDPTTPITTNLMGTFKGLDYFKWAKEMDLISWDNYPAYNTPWSLVAMTHDLMRGLKQQP
FMLMEQTPSQQNWQPYNSLKKPGQMRAQSYQTIAHGADTIQYFQLRRSIGACEKFHGAVI
EHVGHEDTRVFRETAALGAELAQLSDIIGTQTQAQVAVIFDWDNYWALEYTSGPTVDLKY
VEQIHRYYRYFHEQNIAVDLVPVDADLSKYKLVAAPVLYMIKEGMQERLTDFVKQGGSLL
TTYMSGIVDQSDNVHLGGYPGPLRELAGIWVEEIDALAPEQSNGVSLVNEELTGTSNLVS
DLIHLETAEALAHYTSNFYAGMPAVTKNMFGDGTVYYFGGQLEDQLQDQLFKTIVEENDI
TPVIEEATKLEVACRENAEAKFFVIINFHEEAQPLPAMFVGKTDLLTGEVLSSEMMLTQY
TTYIVKEERN
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattttttgatcgaattctattcggcggcgattataatccaaatcagtggccg
aaagagatttgggaagaagacattcggatctttaaaaaagcaagtatcaatagcgcgacc
gtcaatgttttttcatgggcaaagatccaaccctctgaaaattgttatgattttgaggaa
ttggatcaaatcatcgaaaaattaagtacggagggcttcgacatcgtcttagccacttcc
acagccgctttgccagcttggatgtttaagaagtatccggaagtcgctcgcaccgattat
gatggacgccatcataagtttgggcaacggcataatgcctgtcccaatagtttggtttat
caaaaatacgcagaacgtctggcaacgaaattagccgaacgttacggcgaaaatccacaa
gtgacttgttggcacatcaataatgaatacggcggcgaatgttattgcgagaactgtgaa
aaagcgtttcgtgtttggctaaaggataaatatcaaacgatcgaagcactgaataaagcc
tggaatatggaattttggggtcatactgtatatgaatgggatgaaatcgttctgccaaat
gcgctgtcagaaggaatcggctatgacaagacggcatttgcaggaatttctattgactac
cgacgcttcaactcggatagccttttaaaaaactatatgatggagcgggacgctattcgg
aaaatcgatcccacgacaccgattacaacgaatttgatgggaacctttaaaggactggat
tatttcaagtgggcgaaggaaatggaccttatttcgtgggataattatccagcgtataat
acgccatggagtttagtagccatgacacatgatctaatgcgcggcttgaaacaacagccc
tttatgctgatggaacaaacaccctcccaacaaaactggcaaccctataactcattaaaa
aaaccgggacaaatgcgggcgcaaagctaccaaacgatcgctcatggggcggacacgatc
caatatttccaattgcgacgttccatcggtgcttgtgagaaattccatggagctgttatc
gaacatgtcggtcatgaagacacgcgagttttccgagaaacggcagctcttggtgctgaa
ttagcgcagctttcagacattattgggacgcaaactcaagcacaggttgccgtgattttc
gattgggacaattattgggcattagaatatacgagtggtccgaccgttgatctgaagtat
gtagaacagatccatcgctactatcgttattttcatgaacaaaatattgccgtcgacttg
gttcccgtggatgctgacttgtcaaaatacaaattagtcgcagcacctgttctctacatg
atcaaagaaggaatgcaagagcggctcactgatttcgtcaaacaaggtggttctttactt
accacgtatatgagcggtatcgttgatcaatctgacaacgttcacttagggggctatcct
gggccattgcgggagttagctggcatctgggtggaagaaatcgatgcattagccccagaa
caatcaaacggcgtttccttagtcaatgaagaactgacaggaaccagtaatttagtcagc
gatttgatccatttagaaaccgccgaagcgctagcgcattacacaagcaatttctatgca
ggaatgccggcagtgacgaaaaatatgtttggcgatggcaccgtctattactttggtgga
cagttggaagatcagctgcaagatcagcttttcaaaacgattgtcgaagaaaacgatatc
accccagtgatcgaggaagcaacaaaactagaagttgcctgtcgtgaaaatgcagaggcg
aaattcttcgttatcatcaatttccacgaagaagcacaaccgttgccagcaatgtttgtt
ggaaagacggatcttctgacgggtgaggttctttcttcagaaatgatgctgacacaatac
accacctatatcgtcaaagaggagcgtaactga

DBGET integrated database retrieval system