KEGG   Erwinia gerundensis: EM595_0726Help
Entry
EM595_0726        CDS       T04258                                 

Gene name
ddlB
Definition
(GenBank) D-alanine:D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ege  Erwinia gerundensis
Pathway
ege00473  D-Alanine metabolism
ege00550  Peptidoglycan biosynthesis
ege01100  Metabolic pathways
ege01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ege00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    EM595_0726 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EM595_0726 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    EM595_0726 (ddlB)
Enzymes [BR:ege01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EM595_0726 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:ege01011]
 Precursor biosynthesis
  Amino acid ligase
   EM595_0726 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 ATP-grasp ATPgrasp_Ter ATPgrasp_ST TTL GSP_synth
Motif
Other DBs
NCBI-ProteinID: CUU22962
UniProt: A0A0U5GJA3
LinkDB All DBs
Position
1:815009..815929
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGTSAEREVSLNSGNAVLAGLKEAGIDAHAVDIRDVPVWQLKEQGYHKAFI
ALHGRGGEDGTLQAALEFLNIAYTGSGVMASAISMDKLRTKLLWQGAGLPVSPYIMLSRS
EWDAGLTEETTAKISALGLPLFVKPSREGSSVGISRVNEQEALPAALDNAFLHDDEVLIE
QFLSGAEYTVSIVGETLLPSIRIQTANTFYDYEAKYHSDETQYFCPSGLSAEREAELAAI
VLKAWRVLGCSGWGRVDVMMDGAGNFHLLEVNTSPGMTSHSLVPMAAKQAGMSFSALAAR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaagtcgcagtattgctgggtggaacgtctgcggagcgcgaagtttctctt
aactccggtaacgcggtgctcgctggcttaaaagaagcgggtattgatgcgcatgcggtt
gatattcgcgatgtgccggtatggcaactgaaagagcagggctatcacaaggcgtttatc
gctcttcacggacgcggtggcgaagatggcacgctgcaggcagcgctggaatttctgaac
attgcttacaccggcagcggcgtaatggcatcggcgatcagcatggacaagctgcgcact
aagttgttgtggcagggtgccgggttgccggtatcgccttacattatgctgtcgcgcagt
gagtgggacgcaggcctcaccgaagagaccacggcaaaaatttctgcgctgggcttgccg
ctgtttgttaagccgagccgcgaaggatcaagtgtcggtatcagccgggtaaacgagcag
gaggcactgccagcggctctcgataatgcatttttgcatgacgatgaagtgctgattgag
caatttctgagcggtgcggaatataccgtcagcattgtgggtgagacgctgctaccttct
attcgtatccagactgctaatacgttttatgactatgaagccaagtatcattctgatgaa
acgcaatatttttgcccaagtggcttatcggctgaacgcgaagcggaactggcagcgatc
gtgctgaaagcctggcgcgtgctcggttgtagcggctggggccgggttgacgtcatgatg
gacggcgctggcaattttcatctgctggaagttaacacgtcgcccggtatgaccagccat
agtctggtaccaatggcggcaaaacaggcaggaatgagtttctccgcgctggccgcccgt
attctggagttggccgactga

DBGET integrated database retrieval system