KEGG   Erwinia gerundensis: EM595_1547Help
Entry
EM595_1547        CDS       T04258                                 

Gene name
bglY
Definition
(GenBank) Beta-galactosidase BglY
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ege  Erwinia gerundensis
Pathway
ege00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ege00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EM595_1547 (bglY)
Enzymes [BR:ege01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EM595_1547 (bglY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: CUU23781
UniProt: A0A0U5L413
LinkDB All DBs
Position
1:1658487..1660544
Genome map
AA seq 685 aa AA seqDB search
MSKFPPLSARVNALLHGADYNPEQWTQTPGIVDKDIEMMKQAHCNVMSVGIFSWAKLEPA
DGEYDFAWLDSLLDKLQQNNIAVFLATPSGARPAWMSQKYPEVLRVGRDRVPALHGGRHN
HCMTSPVYRQKVREMNSALADRYAHHPAVIGWHISNEYGGECHCERCQSAFRGWLQQRYE
TLDKLNHAWWSDFWSHTYSDWSQIASPSPQGEMSIHGLNLDWRRFMTDQVTDFCAEEIKP
LKAVNPDLPATTNFMEYFYDYDYWKLAQPLDFISWDSYPTWHNEKDETTLACYTAMYHDL
MRTLKQGQPFVLMESTPSATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHLDTRVGREVSELGRMLAAMTPVQGSRVDAKVAIIFDWESRWAMDNA
QGPRNIGLHYERTVTEHYRAFWEQGVAVDVINADVDFSGYSLVIAPMLYMVRDGFAGRAQ
RFVENGGHFVASYWSGIVNESDLCHLGGFPGPLRPLLGIWSEEIDSLAEGEFNAVRGISG
NLLGLSGPYQARELCEHIHLEGATALASYESDFYAGQPAVTVNSVGAGKAWYIASRNDLA
FHRDFYGALITRLALPRALATDFPPGVTAHRRTDGVHSFIFLQNFTARTQTVDLPAGLED
LIAGSPVARSLNLVPWDCRVLRGPL
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatttccaccgctaagcgccagagttaatgcgttactgcatggcgcggactac
aacccggaacagtggacgcagacgccgggcatcgttgataaagacattgaaatgatgaaa
caggcacactgcaacgtgatgtcggttggcatctttagctgggcgaagctcgagcccgcc
gatggcgagtacgattttgcctggctggacagcctgctggataagcttcagcagaacaat
attgcagtgtttctcgccacgccaagcggcgcgcgtccggcatggatgtcgcagaaatac
ccggaagtgctgcgcgtcgggcgcgatcgcgtaccggcgctgcacggtggccgccataat
cactgcatgacctcgccggtttaccggcaaaaggtcagggagatgaacagcgcgctggcc
gaccgttatgcgcaccatccggcggtgattggctggcacatctccaatgaatatggcggt
gagtgccactgcgaacgttgtcagagcgccttccgcggctggctgcaacagcgctacgag
acgctggataagctgaaccacgcctggtggagcgatttctggagccacacctacagcgac
tggtcacaaatcgcctcgccgtcaccgcagggtgaaatgtcgattcacggcctgaacctc
gactggcggcgctttatgaccgatcaggtcaccgatttttgcgccgaagagatcaaaccc
ctgaaggcggtgaatcccgacctgccggctaccactaacttcatggagtatttctacgac
tacgactactggaagctggcgcagccgctggattttatctcctgggacagctatccaacc
tggcacaacgagaaagatgaaaccacgctcgcctgctacacggcgatgtatcacgatctg
atgcgcaccctgaagcagggccagccatttgtgctgatggagtcaacgccgagcgccacc
aactggcaacccaccagcaagctgaaaaagccgggcatgcacattctgtcgtcgctgcag
gcggtggcacacggtgccgattcggtgcagtacttccagtggcgtaaaagccgcggctcg
gtggagaagttccacggtgcggtggtggatcacgtcggccatcttgatacccgcgtgggc
cgcgaagtcagcgaactgggccgcatgctggccgcaatgacgccggtgcagggcagccgc
gtcgacgcaaaagtggcgatcatttttgactgggaaagccgctgggcgatggacaacgct
cagggcccgcgcaacatcggcctgcactatgagcgtacggtaacggaacattatcgcgcc
ttctgggaacagggcgtggcggtggatgtgatcaatgccgacgtcgatttcagcggctat
tcgctggtgatcgcaccgatgctctatatggtacgcgacggctttgccgggcgcgcccag
cgctttgttgaaaacggcgggcactttgtcgccagctactggagcggcatcgttaacgaa
agcgatctctgccatctcggcggctttccggggccgctgcggccgctgctcggcatctgg
tcagaagagatcgacagcctggcagagggcgaattcaatgcggtgcgcggcatcagcggc
aacctgcttggcctgagcgggccctatcaggcgcgcgagctgtgcgaacatattcatctg
gaaggcgccaccgcgctggcgagctacgagagtgatttctatgccggtcaaccggcggtc
acggtgaacagcgtcggcgcgggcaaggcgtggtatatcgcatcacgcaacgatctggcg
tttcatcgcgacttctacggcgcgctgattacccgtctggcgctgccgcgcgcgctggcc
accgacttcccgccgggcgtcaccgcgcaccgtcgcaccgatggcgttcattcgtttatt
ttcctgcaaaactttaccgcgcgcacgcaaacggtcgatctgcctgccgggcttgaagat
ctgattgccggttcgccggtggcccgttcactcaatctggtgccgtgggattgtcgggta
ctgcgcgggccgttataa

DBGET integrated database retrieval system