KEGG   Erwinia gerundensis: EM595_1704Help
Entry
EM595_1704        CDS       T04258                                 

Gene name
sodC
Definition
(GenBank) copper-zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ege  Erwinia gerundensis
Brite
Enzymes [BR:ege01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EM595_1704 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CUU23938
UniProt: A0A0U5GMA3
LinkDB All DBs
Position
1:1830872..1831390
Genome map
AA seq 172 aa AA seqDB search
MKKSVIAAMLLAVGTAHAASEKVELHSVTAKGVGEVIGSVTIEETDWGLQFTPNLSGLTP
GIHGFHVHAKGSCEPATTDGKVVAAGAAGGHLDPTNSGKHLGPYHDGHLGDLPAIFVTDD
GKATYPVLAPRIKKLADISGKALMVHVGGDNHADHPKPLGGGGERFACGVIK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtgtgatcgccgcaatgctgctggccgtgggcaccgctcatgccgccagt
gagaaagtcgaactgcacagcgttaccgccaaaggtgtcggtgaagtcatcggcagcgtc
accattgaagagaccgattggggcttgcagtttacgcccaacctgagcgggttgacgccg
ggcattcatggcttccatgttcatgccaaaggcagctgtgaaccggccacgaccgacggt
aaagtggtggcagcaggcgctgcagggggccatttggatcccaccaacagcggcaagcat
ctgggaccctatcatgacggtcatctgggcgatctgcccgctatctttgtcaccgatgat
ggcaaagcgacctatccggtgctggcaccgcgcatcaaaaaacttgcggatatttctggc
aaagcgttgatggtgcacgttggcggcgataaccatgccgatcatcctaaaccgctggga
ggcgggggcgaacgcttcgcctgtggcgtgattaagtaa

DBGET integrated database retrieval system