KEGG   Erwinia gerundensis: EM595_3283Help
Entry
EM595_3283        CDS       T04258                                 

Gene name
fadB
Definition
(GenBank) enoyl-CoA hydratase / dodecenoyl-CoA delta-isomerase / 3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA epimerase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ege  Erwinia gerundensis
Pathway
ege00071  Fatty acid degradation
ege00280  Valine, leucine and isoleucine degradation
ege00281  Geraniol degradation
ege00310  Lysine degradation
ege00362  Benzoate degradation
ege00380  Tryptophan metabolism
ege00410  beta-Alanine metabolism
ege00640  Propanoate metabolism
ege00650  Butanoate metabolism
ege00903  Limonene and pinene degradation
ege00930  Caprolactam degradation
ege01100  Metabolic pathways
ege01110  Biosynthesis of secondary metabolites
ege01120  Microbial metabolism in diverse environments
ege01130  Biosynthesis of antibiotics
ege01200  Carbon metabolism
ege01212  Fatty acid metabolism
Module
ege_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ege00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EM595_3283 (fadB)
   00650 Butanoate metabolism
    EM595_3283 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EM595_3283 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EM595_3283 (fadB)
   00310 Lysine degradation
    EM595_3283 (fadB)
   00380 Tryptophan metabolism
    EM595_3283 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EM595_3283 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EM595_3283 (fadB)
   00281 Geraniol degradation
    EM595_3283 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EM595_3283 (fadB)
   00930 Caprolactam degradation
    EM595_3283 (fadB)
Enzymes [BR:ege01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EM595_3283 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EM595_3283 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EM595_3283 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     EM595_3283 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: CUU25514
UniProt: A0A0U5L409
LinkDB All DBs
Position
1:3560292..3562475
Genome map
AA seq 727 aa AA seqDB search
MLYQSDTLSLDWLTDGIAELVFNAPGSVNKLDTATVANLGEALTLLENEPALRGLLVSSR
KPAFIVGADITEFLTLFSAPANQLTDWLNDANAIFNRLEDLPVPTLTAVNGYALGGGCEC
VLATDFRVATPDTRIGLPETKLGIMPGFGGSVRLPRLIGADNALEIIAAGKEVDAANALS
LGLVDAIVAPEKLAAAALRMLQAAIEEQSWRARRAPKLQPLKLSAVEAKMSFTTAKALVM
QTAGKHYPAPLTAVKTIEAAAHLGRDGALKLETAAFVPLAQSNEARALVGIFLNDQWVKS
KAKKLAQSARSPQQAAVLGAGIMGGGIAYQSAAKGVPVRMKDIRENALTLGMQEAGKLLN
KQLERGKITGAQLTRIIASIQPTLSFADFDRVDIVVEAVVENPTVKRAVLQETEGQVRSD
TIIASNTSTIPIGDLAQALKRPENFCGMHFFNPVHRMPLVEIIRGEKTADSTLAQVIGWA
LKMGKTPVVVNDCPGFFVNRVLFPYFAAFNLLLRDGADFRQIDKVMEKTFGWPMGPSWLL
DIVGIDTAHHAQQVMADGFPTRMKTPEQNAIDLLFAAQRYGQKNGSGFWRWETDKKGKAV
RQPDAEIAALLQPICQPARSFSDEEIIARMMIPMLNEVVRCLEENIIASPAEADMALVHG
LGFPPFHGGALRYLDTLGNARFVEMAQHYAALGPLYTPPALLLQKAEQHESWYPATPARA
HQPLKSV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcaaagcgataccctttctctcgactggcttaccgatggcatcgccgagctg
gttttcaatgcgccaggctcggtgaataaactcgataccgccacggtagctaatctgggc
gaagcccttaccctgctggaaaatgaacccgcgctgcgtggcctgctggtgagttcacgc
aagcccgcctttattgttggcgccgatatcaccgagtttttgacgctgttttccgctccg
gccaaccagctgactgactggctgaatgacgccaatgcgattttcaaccgactggaagat
ctgccggtgcctacgctgaccgccgttaatggttatgcgctgggcggcggttgcgaatgt
gtactggccaccgactttcgcgttgccactccggatacgcgcatcggcctgccagaaacc
aagcttggcatcatgcccggctttggtggctccgtccgcctgccgcgtttgatcggtgcg
gataacgcactggaaatcatcgcagcgggcaaagaggtggatgccgccaacgcgctgtcg
ctgggtctggtcgatgccattgtcgcgccggagaagctggctgcggcggcgctgcgcatg
ctgcaggcagcgatcgaggagcaaagctggcgggcacgccgtgcgcccaaactgcagcca
ttaaagctctcagcagttgaagcgaaaatgagctttaccactgctaaagcgctggtgatg
cagacggccggtaagcactaccctgcgcccttgactgcggtcaaaaccattgaagcagcg
gcgcatctgggacgcgacggcgcgttgaagctggaaacggctgcctttgttccgctggcg
cagtcaaacgaagcacgcgcgctggtcggcattttcctcaacgatcagtgggtcaaaagc
aaagccaaaaagctcgcacagtcggcacgttcgccacaacaggcggcggtgctgggtgcc
ggaattatgggcggcggcatcgcttatcagtctgccgccaaaggtgtgccggtgcgcatg
aaagatattcgcgaaaatgcgctgacgctggggatgcaggaagcgggcaagctgctgaac
aagcagttggaacgcggcaaaattactggcgcacagctcacccgtatcattgccagcatt
caaccaacgctcagcttcgccgacttcgatcgggttgatatcgtggtggaagcggtggtg
gaaaatccaacggtaaaacgtgcggtgttgcaggagaccgaaggtcaggtacgcagcgat
accatcattgccagcaatacctcgaccattccaattggcgatcttgctcaggcgttgaag
cggccggaaaatttttgcggcatgcactttttcaacccggtgcaccgtatgccgctggta
gaaattattcgtggcgagaaaactgccgacagcacgctggcgcaggtgattggctgggcg
ttgaaaatgggtaaaacgccggtggtggttaacgactgtcccggatttttcgtcaaccgc
gtgctctttccctattttgctgcctttaatctgctgttacgcgacggcgctgatttccgt
cagatagataaggtgatggaaaaaacttttggctggccaatggggccatcatggctgctg
gacatagtaggcatcgacaccgctcatcatgcccagcaggtgatggccgatggtttcccg
acgcgcatgaagacgccagagcagaatgccatcgatctgctgtttgccgcccagcgttac
ggtcagaaaaacggcagcggattctggcgctgggaaacagacaaaaaaggcaaggcggtc
aggcagcccgatgccgaaatcgctgcgttgctacagccgatatgtcagccggcgcgttcc
ttcagcgacgaggagatcatcgcccgcatgatgattcctatgctgaatgaagtggtgcgt
tgcctggaagaaaatatcatcgcctcaccagcggaagcggatatggcgctggttcatggt
cttggcttcccgccgtttcatggcggcgcactgcgctatctcgatacgctcggcaacgcg
cggtttgttgagatggcgcagcactatgccgcgcttggcccgctctatacgccgcccgct
ctgctactgcaaaaagcggagcagcacgaaagctggtatccggccacgcccgcgcgtgct
catcagccgctgaaaagcgtgtaa

DBGET integrated database retrieval system