KEGG   Erwinia gerundensis: EM595_3397Help
Entry
EM595_3397        CDS       T04258                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase, manganese
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ege  Erwinia gerundensis
Brite
Enzymes [BR:ege01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EM595_3397 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CUU25628
UniProt: A0A0U5LT76
LinkDB All DBs
Position
1:complement(3695762..3696379)
Genome map
AA seq 205 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALEGTEFADLPVDELITKL
DQVPADKKTVLRNNAGGHSNHSFFWKGLKIGTTLQGDLKAAIEKDFGSVEKFQEEFEKAA
ATRFGSGWAWLVKKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYYLKYQNK
RPDYIKAFWNVVNWDEAAARFASAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatccctgccttatgcatatgatgcactggaaccgcacttcgac
aagcagacgatggaaatccatcacaccaaacaccaccagacctacgttaacaacgctaac
gcagcgctggaaggtaccgaattcgctgacctgccggttgacgaactgatcaccaaactg
gatcaggttccggctgacaagaaaaccgtactgcgtaacaacgcgggcggccactctaac
cacagcttcttctggaaaggcctgaaaatcggcaccaccctgcagggcgatctgaaagcc
gccatcgaaaaagatttcggcagcgtggaaaaattccaggaagagtttgagaaagccgca
gcaacccgtttcggttcaggctgggcgtggctggttaagaaaggcgacaagctggcggtg
gtgtccactgcaaaccaggacagcccgctgatgggcgaagcgatctctggcgcgtcaggc
ttcccgattattggcctggacgtgtgggaacacgcttactacctgaaatatcagaacaag
cgcccggattacatcaaggcgttctggaacgtagtaaactgggacgaagcagcagcacgt
ttcgcttccgctaagtaa

DBGET integrated database retrieval system