KEGG   Erwinia gerundensis: EM595_p0453Help
Entry
EM595_p0453       CDS       T04258                                 

Definition
(GenBank) xyla
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
ege  Erwinia gerundensis
Pathway
ege00040  Pentose and glucuronate interconversions
ege00051  Fructose and mannose metabolism
ege01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ege00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EM595_p0453
   00051 Fructose and mannose metabolism
    EM595_p0453
Enzymes [BR:ege01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     EM595_p0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CUU26149
UniProt: A0A0U5LAK8
LinkDB All DBs
Position
pEM01:458059..459039
Genome map
AA seq 326 aa AA seqDB search
MSELKFATRLNSFASGANLYWPELQGKPSVLQMIARAGTVNGLTHLDLNYPQHMVSDIPT
MRQAIADAGLAVNGMQMRWDAPQFKIGAFTHPDAKIRREAIELTKRGIDAGREFDSRLMT
LWMGQDGFDYCFQADYKKIWEDAVSAVREIAEYAPDVDISIEYKPNEPRAYSIFPNVTTC
LLAVEEAGSPNLGITLDFAHVLFANEIPAFAAAMVARRSRLMGLDLNDGWGKRDDGLMVG
SVNPRATLEFLWQMQRDGYQGAYYFDTFPDASGLDPVREAELNIITVKRLLKLCDQLEGN
AELTDAISRQDAVSSQQIVNDIMLAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaactgaaatttgctacgcgtctgaattcctttgcctcgggggcaaacctctac
tggcctgaactccagggcaagccctcggtgttgcagatgatcgcccgcgccggaacggtt
aacggcctgacccatcttgatctcaactatccgcagcacatggtcagcgacatccctacc
atgcggcaggcgattgctgatgcaggccttgcggtcaacggtatgcagatgcgctgggat
gcgccgcagttcaaaatcggcgcctttacccatcccgatgcgaagatccgccgtgaagca
attgagctgaccaagcgcggcatcgatgcagggcgcgagtttgattcccgtctgatgacg
ctgtggatgggccaggatggttttgattactgcttccaggccgactacaaaaaaatctgg
gaagacgcggtcagcgcggtacgggaaatcgctgagtatgcgcccgatgtggacatcagc
attgaatacaaacccaacgagccgcgcgcctacagcattttccctaacgtcaccacctgc
ctgctggcggtcgaagaggcgggcagccctaacctcggcattaccctcgactttgcccat
gtattgtttgccaacgaaatcccggcctttgccgccgcaatggtcgcgcgtcgctcacgg
ctgatgggcctcgatttaaacgacggctggggtaaacgtgacgatggcctgatggtcggt
tcagtgaacccgcgcgccacgctggaattcctctggcagatgcagcgtgatggttatcag
ggcgcgtactactttgacaccttcccggatgccagcggcctcgatccggttcgcgaagcg
gagctgaatatcatcaccgtgaaacgtctgctgaagctctgtgatcaactggaaggtaac
gctgagctgaccgacgcgattagtcgtcaggatgcggtaagttctcagcagatcgtcaac
gatattatgctggccagataa

DBGET integrated database retrieval system