KEGG   Echinococcus granulosus: EGR_01192Help
Entry
EGR_01192         CDS       T05553                                 

Definition
(RefSeq) Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
egl  Echinococcus granulosus
Pathway
egl00562  Inositol phosphate metabolism
egl01100  Metabolic pathways
egl04068  FoxO signaling pathway
egl04070  Phosphatidylinositol signaling system
egl04140  Autophagy - animal
egl04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:egl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    EGR_01192
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    EGR_01192
   04070 Phosphatidylinositol signaling system
    EGR_01192
   04150 mTOR signaling pathway
    EGR_01192
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    EGR_01192
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egl01009]
    EGR_01192
Enzymes [BR:egl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     EGR_01192
    3.1.3.48  protein-tyrosine-phosphatase
     EGR_01192
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     EGR_01192
Protein phosphatases and associated proteins [BR:egl01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    EGR_01192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 PTPlike_phytase DSPc Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 36336907
NCBI-ProteinID: XP_024355260
LinkDB All DBs
Position
Unknown
AA seq 775 aa AA seqDB search
MPALNVLLRHTISAHLAVFWQRKRKNCMWHTKNQSSLASTAATVGTATAAASVGGGGGGI
VICSGSTVSSNTFSDHHQQPVPTFENPSFPQQQHPPAKMVNRLKSLVSKKKKRFQADGFD
LDLSYISPRIIAMGFPAERIEGLYRNHIDEVSRFFEMRHKGHYKIYHLCNERDFNEYRFS
GPVVRYPFSDHNAPQFEQILALCQDVMEFLKQHPENVVAINCKAGKGRTGVMVCACLMEL
QEARNAEEALRLYAEKRTRNGQGVTIPSQRRYVQYYSRLLSSALTYEPTPLRLTTIRIEG
LPHQLHGAQSFELSISTYENRLSINHYHDPTSMEEVSHSQGNSVTPITAAVATITPVPAV
SGTVAGTTDNPDYDCHRHSDVTTYQIPCSTHHSNSGSYLIRLDEPVTVFEDFRIKIKAKS
GVLTKKIGQCWLNTFFILLNDPATTPTASAASISSTAVTSTGCCSTSDSNSGSGSSSDSS
ASTASSTSSSVRNSPPHFTRVNEEEEEEELVDEEEEDDEELPTLTSNSTLLHPSPPPSSP
PPIIPPNHAGSAVMMCRSSNPFRFAASKAGVSMPFISIPKKDNGPSSYSSYTKKSSPNAN
LVLAPSMSTQLATPLAVRVLELSQTELDAAAKVRGKKGEEFKVLFEFIRETPCSQSVSTC
SSVNSSNPTTSCSSQRPVVMDLAGVEEVMEVEERIKGTTSLPTTYLQHHHHSFHSPAEST
TNQTGALVSCSASGSCEQPPGSAARRKYLFDPSIIYASVFGEVAGLYTTSFISVN
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgccggccttaaacgtattgttgcgtcacaccattagtgcgcatctagccgtcttttgg
caacgaaaaaggaagaattgtatgtggcacaccaaaaaccaatcttcattggcctccacg
gccgcaaccgtaggaacagcaacggcggccgcgtctgttggtggtggtggtggggggatt
gtcatctgtagcggatctaccgtgagctcaaacaccttttcagatcaccatcagcagcct
gtcccgacgtttgaaaatccctccttcccacagcaacagcatcctcctgccaaaatggtc
aatcgtctcaagtcgctggtgagtaagaagaaaaagcgttttcaagctgatggtttcgat
ttggatctcagttacatctccccacgcattattgccatgggctttcctgcggaacgtatc
gagggtctctatcgcaaccacatcgacgaggtctcacggttctttgagatgaggcataag
ggccactacaagatttaccatctgtgcaacgagagggatttcaatgagtatcgcttctcg
gggccagttgtgcgctatcccttctccgatcacaatgctccccaatttgagcaaattctt
gccctctgtcaggacgtcatggagttcttgaaacagcatcccgagaacgtggtggctatc
aactgcaaggccggcaagggccgtacgggagtgatggtgtgtgcgtgcctgatggaactg
caggaggcaaggaacgccgaggaggcgctaaggctgtacgcagagaagcggacacgtaac
ggtcagggtgtgaccatccccagtcagcgacgctatgttcaatattacagccgtctcctc
tcctccgccctcacctatgaacccacaccccttcgtctgactactattcgcattgagggc
cttccgcatcagcttcatggtgcacaaagtttcgaactgagtatttcgacttacgagaac
cggttgtcaatcaatcactaccacgatcccacttcaatggaggaggtctctcattcccag
ggcaactctgtcacccccattactgccgccgtagctaccatcactcctgtccctgctgtc
agcggtactgttgctggtacaacagacaatcccgactacgactgccatcgtcattcagac
gtgaccacataccaaatcccctgctccacccatcatagcaacagtggtagctacctcatt
cgtcttgacgagccggtaactgtgttcgaggatttcaggataaagatcaaggccaagagt
ggtgtgctcaccaagaagattggccagtgttggcttaacaccttttttatactcctgaat
gatcctgccactactcctactgcttctgccgctagcatatcttccactgccgtcacatcc
acaggctgttgctccacgtctgattcgaactctggttctggctcttcctctgattcctca
gcttcgacagcctcttctacctcttcgtcggtacgaaattctccgcctcattttaccaga
gtgaatgaggaagaggaggaggaggagttggtggatgaggaggaagaggatgatgaagaa
ctcccaacgctcacctcgaattccacgcttcttcatccgtcaccacctccttcctctcct
cctccaattattcctcccaatcatgcaggttccgcagtaatgatgtgtcgcagttcaaat
cccttccgttttgctgcttcaaaggctggcgtctctatgccgtttatctccattccaaag
aaggataatgggccctcgtcctatagcagttacaccaaaaagagctctcccaacgcaaat
ctcgtgctcgctccctccatgtctactcaactggctactccgttagcggtaagggttctc
gagttgtcccaaaccgaactggacgccgcagccaaggtcagaggcaaaaagggagaagag
tttaaggtcctgttcgagttcattcgtgaaacgccctgctctcaatcggtttcgacttgc
agcagtgtgaactcttcgaatccaactacctcttgttcttcccagaggccagtggtaatg
gacctggcaggtgtggaagaggtgatggaggtggaggagcggatcaaaggtaccacctcg
ctgcctactacctacctccagcatcaccaccattccttccattctcccgctgaatctacg
acaaatcaaactggtgctctggtctcgtgctccgcctccgggtcatgcgagcagcctcca
ggctctgctgcacgtcgaaaatacttattcgatccgagtattatttatgcttccgtcttc
ggagaagttgcggggctctacactacatcctttatttcggttaactga

DBGET integrated database retrieval system