KEGG   Echinococcus granulosus: EGR_02312Help
Entry
EGR_02312         CDS       T05553                                 

Definition
(RefSeq) Protein phosphatase 1 regulatory subunit
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
egl  Echinococcus granulosus
Brite
KEGG Orthology (KO) [BR:egl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egl01009]
    EGR_02312
Protein phosphatases and associated proteins [BR:egl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EGR_02312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8 Integrin_b_cyt
Motif
Other DBs
NCBI-GeneID: 36338027
NCBI-ProteinID: XP_024354067
LinkDB All DBs
Position
Unknown
AA seq 346 aa AA seqDB search
MSDVGDLPKATDESGKSAQASAEEDNEKQEQDSFEIDEIEISDRESEDIDINHRRIKRIS
KLETLPNARKLCLRNNLIKVIENLGPLADILIDLDLYDNQITKASCSPPIENLEVLRVLE
VLDLSYNRIRVIENLDSLRSLTKLYLVNNKISRIENLSTLTNLTMLELGANKIRKLENLE
NFPNLEELFVGNNKITKLEGLENLPRLRILSLQCNRITKLEGLDKLLNLEELYLSFNGIS
RIEGLDNLVKLQTLELSRNRISQIENISHLVKLEEFWFNDNLVAEWDQLNILAPMKQLKT
LYMERNPIYYAPNSKCMNTAYRRKILLLLPWLRQLDATLTGVGLRS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgtcggtgatcttcctaaggctactgatgaatctggcaaatcagcacaggct
agtgctgaagaggacaatgagaaacaggagcaagattcctttgagatagatgagattgaa
atctctgatagagaatctgaagatatcgacattaaccatagacgaatcaagcgaatttca
aagctggaaaccttacctaatgcgagaaaattgtgtctcaggaataaccttataaaggtc
attgaaaatttgggaccacttgctgacatattgatagatctggacttgtatgataatcaa
attacgaaggctagttgctcaccccccattgagaacctggaagttttgcgagtgcttgag
gtattggacctgagttataaccgtatccgggtgatagaaaatttggactctttaagaagt
cttaccaagctttatcttgtcaataacaagatttccagaattgaaaacttgtcaactctc
acaaacctaaccatgcttgagcttggtgcaaacaagattcggaaactggagaaccttgag
aacttccctaacctcgaggagttgtttgtgggaaataataaaattacaaagcttgaggga
cttgaaaacctgccaagacttagaatattgagtctgcagtgcaatcgaattacaaagctc
gagggactcgacaaattgttgaatttagaagaactatacctgagtttcaatggtatcagc
cgaatcgagggtttggataatcttgtcaaacttcagacacttgagttatctcgaaacaga
ataagtcaaatcgagaacatatctcacctagtcaaacttgaggagttttggttcaatgac
aaccttgttgccgagtgggatcaactaaacatcctggcgccaatgaagcagctgaagacg
ctctacatggagcgcaatcccatttactatgcgcccaactcaaaatgtatgaacacggct
tatcggcgaaaaatcctcctccttttgccctggctacgacaactcgatgcgacattgacg
ggcgttggcctcagatcctag

DBGET integrated database retrieval system