KEGG   Echinococcus granulosus: EGR_02366Help
Entry
EGR_02366         CDS       T05553                                 

Definition
(RefSeq) Succinate dehydrogenase [ubiquinone] flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
egl  Echinococcus granulosus
Pathway
egl00020  Citrate cycle (TCA cycle)
egl00190  Oxidative phosphorylation
egl01100  Metabolic pathways
egl01200  Carbon metabolism
Module
egl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
egl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
egl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:egl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EGR_02366
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EGR_02366
Enzymes [BR:egl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EGR_02366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 36338081
NCBI-ProteinID: XP_024354121
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MASLVRASFASVAARLGCVPTFAGASRHVSTVGKDYTIIDHTYDAVVVGAGGAGLRAAFG
LANEGFKTACVTKLFPTRSHTVAAQGGINAALGNMEQDHWKFHMFDTVKGSDWLGDQDAI
HYMCEEAPKAVIELENYGMPFSRLENGKIYQRAFGGQSLDYGKGGQAHRCCAVADRTGHS
LLHTLYGRSLRYETDYFIEYFALDLLMENGACRGINAMCLEDGTIHRFRAKNTILATGGY
GRAYFSCTSAHTCTGDGTAMVTRAGLPNEDMEFVQFHPTGIYGAGCLITEGCRGEGGYLI
NSEGERFMERYAPNAKDLASRDVVSRAMTIEIREGRGVGPRKDHCYLKLHHLPPDLLKSR
LPGISETAEIFAGVDVTKEPVPVLPTVHYNMGGVPTNYKGQVITYDAATGKDKIIPGLYA
AGEVACASVHGANRLGANSLLDLVVFGRACALDIAEKCKPGDFGPELHPETGMESVANID
KLRSGKGQFPVSDVRLEMQRTMQEHAAVFRDGPVLKAGVEKMLKLYAAKYDNLKVSDKSL
IWNSDLIEGLELQNLLINAVQTIVAAEARKESRGAHAREDFRQRIDEYDYSKPIEGQTKK
PMSEHWRKHTMSYQNLKTGAVKLEYRPVIDKTLDQNVCPTVPPKIRSY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctttggtccgggcgagtttcgcgtctgttgcagcccggctgggttgtgtgcct
actttcgcaggggcatctcggcatgtttcaacggtagggaaagattatacgattattgac
cacacctatgatgccgttgtcgtcggtgctggcggtgctggtcttcgtgctgcttttggc
ttggctaatgagggctttaaaactgcatgtgtcaccaagctttttccgacacgttcccac
accgtcgctgcccagggtggtattaatgctgctctcggaaacatggaacaggaccactgg
aaattccatatgttcgatacggtgaaaggttcggactggctcggtgaccaggacgctatt
cactacatgtgtgaagaggctcccaaggctgttattgagttggagaactatggaatgcct
tttagccgactggaaaatggcaaaatttaccagcgtgctttcggcggtcaaagtctcgat
tacggtaagggtggtcaagctcatcggtgctgcgctgttgctgatcgtactgggcactcg
cttctccacactctatacggtcgctcactccgttatgaaaccgattacttcatcgagtac
tttgcgctagatcttctgatggagaatggtgcgtgccgtggcatcaacgcgatgtgtctc
gaggatgggacgattcaccggttccgagccaaaaatactatccttgccactggcggttat
ggtcgtgcttatttctcctgcacctctgcacacacttgcaccggtgacggtactgctatg
gtcactcgtgctggcctccccaacgaagacatggagttcgtacagttccatcctaccggt
atttatggcgctggttgtctcatcactgagggctgccgtggtgaaggtggctatctgatc
aacagtgagggtgagcggtttatggaacgctacgctcccaatgccaaggatttggcttca
cgagacgtggtgtctcgtgctatgacgattgaaatccgcgagggtcgtggtgtcggtcct
cgtaaggatcattgctacctgaagctgcatcatctgcctcccgaccttctgaaatctcgg
ctccccggtatctctgagactgctgaaatctttgctggtgttgacgttacaaaggaaccg
gttcctgttctcccgactgtgcactacaacatgggtggtgtgccaactaattacaaggga
caggttatcacttatgatgctgccaccggcaaggacaagatcattcctggtttgtatgct
gctggtgaagttgcgtgtgcatctgtgcacggtgccaaccgtctgggtgctaattcgctt
ctcgaccttgtcgtcttcggtcgcgcttgcgccctcgacattgctgagaaatgcaagccc
ggtgattttggccccgagcttcatcctgaaaccggcatggagtcggtcgccaacattgat
aaactccggagtggaaagggccagttccctgtcagcgatgtccgcctcgaaatgcaacgc
actatgcaagagcatgctgctgtcttccgagatggtcctgtgttgaaggctggtgtcgaa
aagatgttaaagctctacgccgccaaatacgacaaccttaaggtgtctgacaagagtctc
atatggaactcggaccttattgaaggtcttgaactgcagaatctcctcattaacgctgtg
cagacgattgttgctgctgaggccaggaaagagtctcggggtgctcatgcccgtgaggac
tttaggcagagaattgatgaatacgactactcaaagccgattgaaggtcaaaccaagaag
ccaatgagtgaacactggaggaaacacacgatgagctaccaaaacctcaagaccggtgcc
gttaaacttgagtacagacccgtgattgacaagactttggatcagaacgtctgccccacc
gtgcctccgaaaatccgttcctactaa

DBGET integrated database retrieval system