KEGG   Echinococcus granulosus: EGR_07425Help
Entry
EGR_07425         CDS       T05553                                 

Definition
(RefSeq) Double-strand break repair protein MRE11A
  KO
K10865  double-strand break repair protein MRE11
Organism
egl  Echinococcus granulosus
Pathway
egl03440  Homologous recombination
egl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:egl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EGR_07425
   03450 Non-homologous end-joining
    EGR_07425
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egl03032]
    EGR_07425
   03400 DNA repair and recombination proteins [BR:egl03400]
    EGR_07425
DNA replication proteins [BR:egl03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     EGR_07425
DNA repair and recombination proteins [BR:egl03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     EGR_07425
    BRCA1-C complex
     EGR_07425
   NHEJ (non-homologous end-joining)
    MRX complex
     EGR_07425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2 SH3_9 DUF273
Motif
Other DBs
NCBI-GeneID: 36343140
NCBI-ProteinID: XP_024348961
LinkDB All DBs
Position
Unknown
AA seq 680 aa AA seqDB search
MEKDGIRGSDTFKTLEEILCLGQEHKVDFILQGGDLFHEVRPSIRCLNEVLRLFRTHCLD
ESPVQFELLSNPALIFANTSYPGVNYLDLNLNIGLPIFAIHGNHDDPSGFGSVCPPDLLH
TCGFINLFGKFDSVEELEVSPLLFRKGSTNLAIYGIGAIREERLHRLFRDNKITFLRPDQ
GEWFSIAVIHQNRVRHGPTGYLPENFLPSFLDLVVWGHEHSCRIEPEWNGTGNFYVIQPG
SSVATSLSEGEAVEKCAGLLEIRDMEFKLTKLPLRSVRRFVFEEVVLKDELSEVDVNSPD
VGLRVEQLCTARIQAAIDQAVVVTAESRQQERVVKAEEGASEAMIFKQPSEPLVRLRVDT
SGGFERFSALRFGQKFVGRVANPKDLITFTTKRDDATCRGTAINTTAFSQPGTGLNSATE
RGGFSVNDVEFFISRYFASNSKLQLELLTEVEMATALRHFVIGADNEAIHTTVAKMMAQT
RGHLAEVRCGEEEIIPEVMRFANIRRKAEVDDKAASGGPPMHESTPSASVIDAGSVKTES
IEEAISDTSVSTRRRLKRITSPFVATSSDESRGETEDQMLLNIIEEVSEDGENVFRTGCD
RPSSSAHSISEKQNSTGRRRGGGRRGFGGKAPRRGFGLTRRAAAAIPEISDTEAICIDSG
ESNDFGEISFDLRRKRGRRG
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagatggaatacgtggcagcgacacttttaagactctagaagaaattctctgt
ttgggacaagaacataaggttgattttatcctgcaaggtggcgatctcttccacgaggtt
cgtccctccattcgatgtctgaatgaagtcctccgactttttcgcacccactgcctcgac
gaaagcccagttcaattcgaactgctcagcaatcctgcgctcatcttcgccaacacttcc
tatcctggtgtcaactacctcgatttaaatctcaacattggcctccccatcttcgccatc
cacggcaaccacgacgacccgagcggatttggcagcgtctgtcctccagacctcctccac
acctgtggtttcatcaacctcttcggcaaattcgatagtgtggaggaactggaagttagc
cctctcttgtttcgcaagggttctaccaatttggcaatctatggaattggcgcgattcga
gaagagcgcttgcatcgtctctttcgtgacaacaagatcacctttcttcgaccggaccag
ggcgagtggttttcgatcgcggtaattcatcagaaccgagttcgtcatggacccactgga
tatcttccagagaactttttgccctcatttctcgatctagtggtttggggacatgagcac
agctgtcgaattgagccagagtggaatggtacgggcaatttctacgtaatccaaccggga
agttcggtggccacctcgttgagtgaaggcgaagcagttgaaaagtgtgccggtctcttg
gagattcgagacatggaattcaagttgactaaactgccattgcgctcggtacgcaggttc
gtgttcgaggaggtggtattgaaagatgagttatcagaggtagacgtcaattcacccgat
gtgggcttgcgcgtggagcagttgtgtactgcgcgcatccaggcagctatcgatcaagct
gtcgtggtgaccgcagaatcacgtcagcaggaacgcgtggtgaaggcagaggagggtgcg
tcagaagcgatgatattcaaacagccgtcagaaccgctggtcagactgcgcgttgacaca
agcggtggttttgagagattcagcgcacttcgatttggtcagaagtttgttggacgcgtg
gccaatcccaaggacctgatcaccttcactaccaagcgcgatgacgctacgtgtcgtgga
accgccattaacaccactgccttctctcagcccgggacaggtttgaattccgcaacggag
cgaggcggcttttcagtaaacgatgtggaatttttcatcagccgttactttgcctcaaac
tctaagctccagttagagctcctcaccgaggtggagatggccacggcgctgcgccacttc
gtcattggtgctgacaacgaggccatccacactactgtggcaaagatgatggctcagact
cggggtcatctggctgaagtccgatgtggtgaagaggaaatcatcccagaggtcatgcga
ttcgcaaacattcgtaggaaagctgaggttgatgataaagctgcaagtggtggacctcca
atgcacgaatctactccttccgcttcagtcattgatgccggttctgtcaaaacagagtcc
atagaggaagctatatcggacacatctgtatctacccgcagacgattgaaacggataacc
agccccttcgttgccacctcttcagatgagtcgcggggtgaaacagaagatcaaatgctt
ctgaatatcattgaggaggtgtcagaggacggtgaaaatgtttttcgtaccggctgcgat
cgaccaagttcgagtgcccattcgatttctgaaaaacaaaattccaccggccgcagacga
ggaggtgggagacgtggatttggcggtaaggcccctcggagaggctttggcctcacaagg
cgtgcggctgcagctatccccgaaatttcagacactgaggcgatctgcatcgattcggga
gaatccaatgacttcggcgagatatcattcgaccttaggcggaaaagaggtcgacgtgga
tga

DBGET integrated database retrieval system