KEGG   Echinococcus granulosus: EGR_08499Help
Entry
EGR_08499         CDS       T05553                                 

Definition
(RefSeq) Lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
egl  Echinococcus granulosus
Pathway
egl00052  Galactose metabolism
egl00500  Starch and sucrose metabolism
egl01100  Metabolic pathways
egl04142  Lysosome
Brite
KEGG Orthology (KO) [BR:egl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EGR_08499
   00500 Starch and sucrose metabolism
    EGR_08499
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    EGR_08499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egl04147]
    EGR_08499
Enzymes [BR:egl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     EGR_08499
Exosome [BR:egl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EGR_08499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 36344214
NCBI-ProteinID: XP_024347834
LinkDB All DBs
Position
Unknown
AA seq 903 aa AA seqDB search
MSVFRVQPTPLGSLLFVLFLLHSQLCFAAVNNPACDAVPNPSRLDCHPEPMATEAECLHR
NCCWSLVDHDRTIACYFPANYPTYKPTGKIFRSGCGFLLSAKRLPGAYSVPPEPIDEVQM
NVAFETETRVRVRITDPHAERWEPDLELDPPDSQCPRNMKYSVAVDISRLGFSISRVEDQ
GKEVVLIDSTGLMASAFVYANQFLQMAFKVRAIHGYGLGEREDSFPIDMHDWKRMVFWAR
DDIPRPNANLYGVHNFFLGLSPDGTAFGMFFLNSNSMEVTKQPLPSLTFRTTGGILDFFL
FVGPTPNEVVAQYYQLIGHPPVPPYWALGFQLCRYGYTGVEEIRETVERNRKAGIPQDVQ
WLDIDYMDVYRDWTLSKKDEFKGLAQFFYTELREKYGLRTVIIVDAGIPSQAGDDYAPYQ
KGLVAGVFVNDSRTGKPLKGLVWPGETVYPDFTKNETLQWWYECARDFQQQLPYDGLWID
MNEPSNFIDGSNQGCDHSSRLDYPPYTPQVSGGSLSFRTICPSALHANGVPHYNLHNLYA
LDEAKATYRALQRIFPGKRTFILTRSSFAGAGRYTAHWSGDITSTWSEMAASIPQMINFN
LFGIPFFGADICGFVDNTTEELCIRWSQLGAFYPFSRNHNTLGARLQDPAVWSTQAQKAI
AKALDMRYQLLPYLYTLLHGAKNHGRMVVKALAFDYPTDLATHHNAKQFLLGSCLNVAPV
LGEGMDFTPLYLPQGEWVEFSSLKRYQSLGKFYPVPAPLDKIPVFYKAGCILPMHPSGPI
NTQEARKMGIGVTVVLLNGTAGGEMVWDDGETEDGEVLNVTFGVIHQKLTANAIINKGGR
VGPVGPVPLAFIRIIGITRKPSIVNLNGTKCDFTFNSKTEQFTVTKFTQPIDLKDSWDLT
WDW
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgttcagggtgcagccgacacccttaggtagcctcctttttgtcctcttcctc
ctccactcgcagctgtgctttgcagctgttaataaccctgcctgtgatgccgtaccaaat
cccagccgtttggactgtcatcctgagcctatggcgacggaggcagagtgcctccatcgt
aactgctgctggagtctcgttgatcacgaccgcacaatcgcctgctacttcccagccaac
tatcccacttacaaaccaactgggaaaatcttcagatctggttgcggttttttgttatct
gcaaaaagattgcccggtgcttactccgtgcctccggaaccgatagacgaagtacagatg
aatgttgcttttgaaacagaaacgcgcgttcgggtgcgcattaccgacccccatgcggag
cgctgggaaccagatttggaactcgatccaccagattctcagtgtccgagaaatatgaag
tactccgtggctgtggatattagtagattgggcttcagtatctcacgtgtggaagaccaa
ggtaaggaggtggttctcatcgactccactgggcttatggccagcgctttcgtctatgcg
aatcagttcctccaaatggcttttaaagtacgcgctattcatggttatggtctgggggag
agggaggactctttccccatcgacatgcatgactggaagaggatggtattctgggctaga
gacgatataccccgaccgaatgccaacctctacggcgttcacaacttcttccttggattg
tctcctgatggcacggcatttggaatgttcttcttaaacagcaactctatggaggtgact
aaacagcctcttccatcactcaccttccgtacaactgggggaatcctcgacttcttcctt
tttgtcggtccaacaccgaacgaggtcgtcgcccaatattaccaactaattggtcacccg
ccggtgccaccctattgggctcttggttttcaactctgtcgttatggctacacaggagtg
gaggagatccgtgagaccgttgaaagaaatcgcaaagcaggtatcccgcaagatgtacag
tggttggatatcgactatatggacgtctatcgagattggacgctgtcgaagaaggatgaa
ttcaagggcttggcacagttcttctacactgaactacgtgaaaagtatggtcttcggaca
gtgatcatcgtcgacgcgggtattccttctcaggccggcgatgactacgcaccgtaccag
aagggtctagttgctggagtcttcgtgaatgacagccggacagggaagccacttaaagga
ctggtatggccaggtgagacggtgtatcccgattttacaaagaatgaaaccctccagtgg
tggtatgaatgtgcaagagactttcaacaacagctcccatacgatggtctctggatcgat
atgaatgaaccatccaatttcatagatggctcgaaccagggttgcgaccactctagtcga
ctagactaccctccatacactccacaggtatccggaggtagcctctccttccgaaccatc
tgtccatcggctcttcacgccaacggtgttccacactacaacctccacaatttgtacgcc
ctcgatgaggctaaagccacctacagagcactacaacgcatcttcccgggaaaaagaact
ttcatcctcactaggtcctcgtttgcaggagcggggaggtacacagctcattggtctggt
gacatcacttcaacgtggagtgagatggctgcctcaattcctcagatgatcaacttcaac
ctctttggcatcccattcttcggggcagacatctgtggcttcgtcgacaacaccaccgag
gagctctgtattcgctggagccaattgggtgcattttatcccttttcacggaaccacaac
acccttggagcgcgacttcaagatcccgcagtttggtccactcaagctcaaaaagcgata
gcgaaagcactcgatatgcgctaccaactgctgccttatttgtacaccctccttcatgga
gcaaagaatcatggaagaatggtggttaaggctctagcttttgactaccccactgatctg
gcaactcatcacaacgccaaacagttcctcctcggttcttgtctcaacgtggctccggtt
ctgggcgaagggatggactttacaccgctttatttaccacagggagaatgggtggagttc
tcaagcctaaagcgttatcagtccttggggaagttctaccccgttcctgcaccactggac
aaaatcccagtcttctacaaggctggctgcattctaccaatgcatccgtctgggccaata
aacactcaggaagctaggaagatgggcattggtgtcactgtagtgctactaaatgggacg
gcgggcggagaaatggtgtgggacgatggggagacggaggatggcgaagtgttgaatgtc
accttcggtgtcatacaccagaagctaacggcaaatgcgattatcaacaaaggaggcaga
gtcggtccagtagggccagtgccactggctttcattcggataatcggtatcacacgaaaa
ccttcaattgtcaacctcaatggcacaaagtgcgatttcaccttcaactccaaaaccgaa
cagttcaccgtgaccaaattcacccagcccatcgatttaaaagattcatgggacctcacg
tgggactggtaa

DBGET integrated database retrieval system