KEGG   Echinococcus granulosus: EGR_10923Help
Entry
EGR_10923         CDS       T05553                                 

Definition
(RefSeq) N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
  KO
K13985  N-acyl-phosphatidylethanolamine-hydrolysing phospholipase D [EC:3.1.4.54]
Organism
egl  Echinococcus granulosus
Brite
Enzymes [BR:egl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.54  N-acetylphosphatidylethanolamine-hydrolysing phospholipase D
     EGR_10923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 36346638
NCBI-ProteinID: XP_024345417
LinkDB All DBs
Position
Unknown
AA seq 385 aa AA seqDB search
MRGSRSGNGSDKASNMFGLHIERIFVLWQSMAENLTQVKITSWGRFANPWSTWEDTRLRA
GFVLGFTAGDVDCSPSPSDLRLACHLPIYRPKFEAKGDGVRLTWLGHSSVLVYVDGVRVL
CDPVFSERCSASQYIGPRRYRPPPCKVEDLPPIDAVVISHNHYDHLDVNSVRGLSDRFPQ
AHWFVPSGCRDFILSTANEANESRVHDFLWWEERPVGDTGVKAVFTPTQHWSARNFLFDS
FAPVIGRMFVLQTLWGSWALIGPKHRVWFGGDTGYCDAFKEIGGHLGPFDVAAIPIGAYE
PRWVLKSQHVNPWEAVEIHKDIRAKYSVGIHWGTFPLTQESFMAPKTALEKALQTAGLHP
SEFRTIHHGQSLCFHRDSSEDASVE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagggggtcaaggtcagggaacggtagtgacaaggcatccaacatgttcggtctgcac
attgagaggatttttgttctgtggcagtcaatggcggagaatttgacccaagtcaagatc
actagttggggtcgttttgccaacccttggtcgacgtgggaggacactcgtttgcgcgct
ggttttgtcctcggtttcaccgccggggatgttgactgttctccttcgccttctgatctt
cggctcgcctgccatttgcccatctatcgacccaaattcgaggcgaagggtgatggggtg
cgtcttacctggcttggacactcatctgtgctagtctacgtcgatggtgttcgtgtgctc
tgcgaccccgtcttctcggagcgctgctctgcttcacagtacattggtccgcgcagatac
cgacctcctccttgcaaggtagaggacctaccacctatcgatgcagttgtcatatcgcac
aaccactacgatcacctagacgtgaacagtgttcgtggccttagtgaccgcttccctcaa
gcccattggttcgtgcccagtgggtgccgtgacttcattctcagtactgccaatgaagcc
aatgagagtcgtgtgcacgactttctgtggtgggaggagcgaccagtcggagacaccggt
gtcaaggccgtcttcacaccaactcagcattggtcagcgcggaactttctgtttgacagc
tttgctccagtaatcggtaggatgtttgtgcttcagacactctggggaagctgggctctg
atcggacccaaacatcgcgtttggtttggtggtgatacgggttattgtgatgcgttcaaa
gaaatcggtgggcatcttggtccgtttgatgtggctgctattccgatcggagcttacgaa
cctcggtgggttctaaagtcgcaacacgtgaatccatgggaggctgtggaaattcacaag
gatatcagagccaagtactccgtcggtatccactggggtacctttcctcttactcaggaa
tccttcatggcaccgaaaacggctttggagaaggcgctgcagactgcaggtctacatcca
tccgaatttcggaccatccatcatggtcagtcgctttgcttccatcgtgacagcagtgaa
gatgcttctgtcgagtaa

DBGET integrated database retrieval system