KEGG   Elizabethkingia bruuniana: AYC65_05480Help
Entry
AYC65_05480       CDS       T05037                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
egm  Elizabethkingia bruuniana
Pathway
egm00564  Glycerophospholipid metabolism
egm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AYC65_05480
Enzymes [BR:egm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AYC65_05480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Pyr_redox_3 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Thi4 GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: AQX84497
LinkDB All DBs
Position
complement(1162224..1163825)
Genome map
AA seq 533 aa AA seqDB search
MKRKEELTKVSQDQEWDFIIIGGGASGLGSALDATTRGFRTLLLESHDFAKATSSRSTKL
VHGGVRYLAQGNIDLVKEALYERGLLAKNAAHLVKNQSFIIPNYNWWGGIYYKIGLSVYD
FLAGKLSLGKTRYINKAQTVEKLPTIEQKGLASGVVYQDGQFDDSRLAINLAQTIVEKGG
TVINYTKVVGLLKNESNKITGVIAEDQFTKERYEIKAKAVVNATGVFTNDILNMSNPKHG
KFVVPSQGIHFVLDKSFLKSNDAIMIPKTSDGRVLFVVPWHERALIGTTDTLVDEPSFEP
KALESEIDFVLKTARQYLSKKPTKEDVLSVFAGLRPLAAPKDGGKSTKEVSRSHKVIVAE
TGLVTITGGKWTTYRQMAEDTIDKAIEVHNLKKVPSKTKELSIHGNIPAKDVDRSNHLYI
YGSDIPAIKALQQEKPEYAERIHPNNEFTVAEVVWAIRNEMAETIEDVLARRVRLLFLDA
RAAIDSARKVAEIFAQELGWDAEKVENETESFISLAKEYLLVPYTTNEMKNSK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaaagaagagcttacaaaagtttcacaagatcaggaatgggactttataatt
atcggaggtggtgccagcggactagggtctgctctggatgctacaacgagaggtttcaga
actttgttactggaatcccatgattttgctaaagctacttcaagccggagtaccaaactt
gtgcatggtggtgtaagatacctggcacagggaaacatagaccttgtgaaggaagccctg
tacgaaagaggacttctggcgaaaaatgctgctcaccttgttaaaaatcagtcttttatt
attccgaattataactggtggggcggtatatattataaaataggattatctgtttacgat
tttctggcggggaaactcagccttggtaaaaccagatatatcaataaagcacaaaccgta
gaaaagcttccaactatagaacaaaaaggtcttgccagcggtgttgtgtatcaggatggg
cagtttgacgattcccgtttggccattaaccttgcccagactatagtagaaaaaggcggt
actgtaatcaattatacgaaggttgtaggtcttctgaaaaacgaaagtaataaaattaca
ggagtaatagctgaagatcagtttactaaagaacgctacgaaataaaagcgaaagctgta
gttaatgcaacaggggttttcaccaatgacatcctgaacatgagtaatccaaaacatgga
aaatttgttgttccaagtcagggaatccatttcgtattagataaatcattcctaaagagt
aatgatgctatcatgatccctaaaacttctgacggacgtgttcttttcgttgttccatgg
catgagagagccttaattggtactacagacacattagtagatgaaccgagtttcgaaccg
aaagctctggaatccgaaattgatttcgttttgaaaaccgcaagacaatatctgtctaaa
aagccaactaaagaagatgtactttctgtatttgcaggcttacgtcctttagcagcacca
aaagacggaggtaaaagcacaaaagaagtatcccgaagtcataaagttattgtagccgaa
accggtcttgtaaccattaccggcggaaaatggactacctaccgacaaatggctgaagat
actatagataaagcaatagaagttcataacctgaaaaaagttccttctaaaactaaggag
ctttctatccacggaaatatcccggcaaaagatgttgacagaagtaatcacctgtatatc
tatggttcggatattccggctataaaagcactacaacaggaaaagcctgaatacgcagaa
agaatacatccaaacaatgaatttacagttgctgaagttgtatgggcaatccgaaatgaa
atggctgaaactatagaggatgtactggccagaagagtccgtcttcttttcttagatgcc
agagcagccatagattcagcacgaaaagtagcagagatctttgctcaggaactcggatgg
gatgctgaaaaagtagaaaacgaaactgaaagtttcatttcactcgctaaagaatatctt
cttgtaccctataccaccaacgaaatgaaaaactctaaataa

DBGET integrated database retrieval system