KEGG   Elizabethkingia bruuniana: AYC65_08285Help
Entry
AYC65_08285       CDS       T05037                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
egm  Elizabethkingia bruuniana
Pathway
egm00620  Pyruvate metabolism
egm00680  Methane metabolism
egm01100  Metabolic pathways
egm01120  Microbial metabolism in diverse environments
egm01200  Carbon metabolism
Module
egm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:egm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYC65_08285
  09102 Energy metabolism
   00680 Methane metabolism
    AYC65_08285
Enzymes [BR:egm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AYC65_08285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4070
Motif
Other DBs
NCBI-ProteinID: AQX85004
LinkDB All DBs
Position
complement(1773068..1775605)
Genome map
AA seq 845 aa AA seqDB search
MKTNEQVEKFRQIVKNKFQIYNSLFMSLPYDKMTNIGMLLPFLHEESKEGYENGKSPMEV
MKHFFDSHTDLKTEEERIDLLFRIIQYVERQVVLFDSIEDSAFSTLNANTDPGTVRNLYE
VASQQGKLNIIKEKMEQFGVKVVFTAHPTQFYSNSVQSILHDLNQAIKTDSVTNIDMLLQ
QLGMTSFINQEKPTPYDEAQSIIYYLRYVYYDTLGELYRDTKRIFDDAHINPHLFQLGFW
PGGDRDGNPFVTAEITQRVSSELRLAILKCYYEHLKKLRKRITFPKVTEMLRQISERVYQ
NIFENKYDLTAGEFKKALQDIRHEVKENNNGLFIDKIDDLIGRIDLFGIYFASLDIRQNS
KIHYKALEQIFEKEFGKDYHALNEDEKLNLLLNTTLQVNPENYSDDIVKDTLKNIYQVKD
IQELNGEKSIHRYIISDSSSIYDVLNVYALFKYCGYADKDIKIDIVPLFETIEGFENAEA
TMNRLYNLAQYKEHLNRRNGRQFIMLGFSDGTKDAGYIKANWDIYTTKEVLSKVSDENDI
KVIFFDGRGGPPARGGGKTHQFYAAQGKSIANHQIELTIQGQTITSVFGTKDQATFNFEQ
LLTAGLENEIFPQDKINLKDWERALLNELAGISYQKYKALKDHPLFVPYLEEVSTLKYYG
RTNIGSRPSKRNDGQLVFEDLRAIPFVGSWSLLKQNVPGYFGVGTALQRLKEEGRLEDLK
KLYRESMFFKTLIQNSMMSMSKTYFPLTYYLRNDKVFGEFWQILHNEYLLTHEMLLEIAN
YKSLMEEEPLSKSSIKMRENIVLPLLTIQQYALQKIKEENPHKETYEKIVTRALFGNINA
SRNSA
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaatgaacaagtagaaaaattcagacaaattgtaaaaaacaaatttcagatc
tataatagccttttcatgagccttccatacgataaaatgaccaatatcggaatgctcttg
ccttttctccatgaagagagtaaagaaggctatgaaaacggaaaatctccaatggaggta
atgaaacatttcttcgacagtcatacagacctgaaaactgaagaggaacgaatagatctt
ctgttccgtattatccagtatgtagaaagacaggtagtattatttgacagtattgaagat
tcggcattttctacactaaatgccaatactgatcccggaactgtccgtaatttgtacgaa
gttgcatcccagcaaggaaaactgaatattattaaagagaaaatggagcagtttggtgtt
aaagttgtgtttacagcacacccgacacaattttattctaattccgtacaatccattctc
catgatctgaatcaggctataaaaacagattcggttaccaatatcgatatgctcctgcag
cagttgggaatgacgtcatttatcaatcaggaaaagccaacaccttatgacgaggctcag
agtattatctattatctgcgctatgtttattatgatactctgggagagttgtaccgggat
accaaacggatttttgacgatgcacacataaatccgcatttattccagttaggcttttgg
ccgggaggggacagagacgggaatccttttgtaaccgcagaaattactcaacgtgtatct
tcagaattaaggcttgctattcttaaatgttattatgaacatctgaagaaactccgcaag
agaattactttcccgaaagttaccgaaatgctgagacagattagtgaaagggtatatcag
aatattttcgaaaacaaatacgaccttactgccggagaattcaaaaaagctttacaggat
ataagacatgaagtaaaagaaaataataacggattgtttattgataaaattgatgatctg
ataggacgtatagatttatttgggatctatttcgcttcgctggacattcgccagaacagt
aaaatccattacaaagcgctggaacagatttttgaaaaagagtttggtaaagattaccat
gcattgaatgaagacgaaaaattgaatctgcttctcaacactactttacaggttaatcct
gaaaattatagtgatgatatagtaaaggatacattgaaaaacatctatcaggtaaaagat
attcaggagctaaatggagagaaaagtattcaccgttatattatttcggacagttcttct
atttatgatgttctgaatgtttatgccttatttaaatattgtggttatgccgataaggat
ataaaaatagatattgttccgttgttcgaaaccatagaaggctttgaaaatgcagaggca
acaatgaacaggctttataaccttgctcaatataaagaacatctgaatcgccgtaatggc
agacaatttattatgcttggattttcagacggaacaaaagatgccgggtatataaaagca
aactgggatatttatacaaccaaagaagtactgtcaaaggtttcggatgaaaacgatatc
aaagttatattctttgatggtagaggcgggcctcctgcacgtggtggtgggaaaacacac
cagttttatgcggcgcaggggaaaagtattgccaaccaccagatagaattaacaattcag
gggcaaacaattaccagcgtttttggaacgaaagatcaggcaactttcaactttgagcag
ttgcttacagcaggattagaaaatgaaatttttcctcaggacaaaataaatctgaaagat
tgggaaagagctttgctaaatgagcttgccggaattagctaccagaaatataaagcactg
aaagatcatcctctttttgtgccttatctggaagaggttagtacactgaaatattatgga
cgtaccaatatcggaagccgtccgagtaagagaaatgacggtcagctggtattcgaagat
ctgagagcaatcccgtttgtaggatcatggagtttgctaaaacaaaatgtacccggatac
ttcggagtgggtacggctttacaaagattaaaagaagagggaagactggaagatttgaaa
aaactatacagagaatctatgttcttcaagacccttattcagaatagtatgatgtctatg
agcaagacttactttccactgacctattatctgcgtaatgacaaagtatttggtgaattt
tggcagatcctgcacaatgaatacctgctgactcatgaaatgttattggaaatagccaat
tacaaatctctgatggaggaagaaccattgtctaagagttctattaaaatgagagaaaat
attgtgctgccgttgctaacgattcagcaatatgctttacaaaagattaaagaagagaat
ccgcataaagaaacctatgaaaaaattgtcacaagggcattattcggaaatattaatgcg
agtcgtaattcagcatag

DBGET integrated database retrieval system