KEGG   Elizabethkingia bruuniana: AYC65_09640Help
Entry
AYC65_09640       CDS       T05037                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
egm  Elizabethkingia bruuniana
Brite
Enzymes [BR:egm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AYC65_09640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AQX85254
UniProt: A0A1T3MKI8
LinkDB All DBs
Position
complement(2082327..2083007)
Genome map
AA seq 226 aa AA seqDB search
MKLFGAATLGFVLVAQLVSAQFKQAPLPYAYNALEGSIDAQTMEIHYSKHGAAYVANLNK
AITGTPLEKESLVKILSGISKQTPAVRNNAGGHYNHELFWTILTPEKNTQPSEKLAKAIN
QSFGSFDAFKEKMSKAGADRFGSGWAWLIVTPEKKLAITSTANQDNPLMDIAEVKGIPVL
GIDVWEHAYYLKYQNKRADYLSAIWNVINWKEINKRYEAALNGKTE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatttggagcagccacattaggctttgtacttgtggcacagctggtatcagca
caatttaagcaagcaccattaccttatgcttataatgcattggaaggatcaattgatgca
caaacaatggaaatacattatagcaagcatggagcagcgtatgtagcaaatttaaataag
gctatcaccggaacacctctggaaaaggaaagccttgtgaaaatactttccggaatctcg
aaacagactcctgcggtaagaaataatgctggtggtcattataaccacgagttgttctgg
acaatccttacacctgaaaagaatacacaaccatcagaaaaactggcaaaagctattaat
cagtcttttggaagcttcgatgcttttaaagaaaaaatgagcaaagccggagcagatcgt
tttggttctggttgggcatggcttattgtaacgccggagaagaaactagctattacttct
actgcaaatcaggataatccattgatggatattgctgaggtgaaaggtatacctgtttta
ggaatcgatgtatgggaacacgcttactatctgaagtatcagaataaaagagctgattac
ctaagtgctatctggaatgtaattaactggaaagagattaataagagatatgaagccgct
ttaaacgggaagactgaataa

DBGET integrated database retrieval system