KEGG   Elizabethkingia bruuniana: AYC65_17325Help
Entry
AYC65_17325       CDS       T05037                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
egm  Elizabethkingia bruuniana
Brite
Enzymes [BR:egm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AYC65_17325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD Big_3_5
Motif
Other DBs
NCBI-ProteinID: AQX86660
LinkDB All DBs
Position
3709755..3710264
Genome map
AA seq 169 aa AA seqDB search
MKNLKILSLGILGAVFTVSCATKEVSYAITPKSGTATGGTVTFKQMGKNVVMNVDAKGLT
PGVHAIHIHDKPDCSAPDGTSTGGHWNPAGSDHGKWGAEHFHMGDIGNLNADDKGNAKLT
FKTSKWCIGCTDNTKNILNHGLIIHAAADDFHTQPTGNAGGRVGCVEIK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaaaaatattatccttaggtattctgggagctgtatttacagtttcatgt
gcaactaaggaagtaagttatgctattacccctaaaagcggaacagcaacaggaggaaca
gtaacctttaaacagatgggaaaaaatgttgtaatgaatgttgatgcaaaaggattaaca
ccaggggtacatgctattcatattcatgacaagccagactgctcagctccggacggaaca
tctaccggcggacactggaatcctgcaggaagtgaccatggcaaatggggtgcagaacat
ttccatatgggagatataggtaaccttaatgctgatgataagggtaatgcaaaattgact
tttaaaacaagtaaatggtgtattggctgcactgataatactaaaaatatcctgaatcac
ggactaatcatccatgcagctgcagacgactttcatactcagcctactggaaatgctggc
ggacgagttggatgtgtagaaattaaataa

DBGET integrated database retrieval system