KEGG   Erythrobacter gangjinensis: BMF35_a0175Help
Entry
BMF35_a0175       CDS       T04581                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
egn  Erythrobacter gangjinensis
Pathway
egn00473  D-Alanine metabolism
egn00550  Peptidoglycan biosynthesis
egn01100  Metabolic pathways
egn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:egn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BMF35_a0175
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMF35_a0175
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BMF35_a0175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:egn01011]
    BMF35_a0175
Enzymes [BR:egn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BMF35_a0175
Peptidoglycan biosynthesis and degradation proteins [BR:egn01011]
 Precursor biosynthesis
  Amino acid ligase
   BMF35_a0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 HTH_51
Motif
Other DBs
NCBI-ProteinID: APE27004
UniProt: A0A0G9MVZ2
LinkDB All DBs
Position
I:complement(177155..178120)
Genome map
AA seq 321 aa AA seqDB search
MARLDPLHVLVLMGGWANEREVSLMSGKGVADALESVGHRVTRLDMDRDVAAKIAEAKPD
VVFNALHGAPGEDGTVQGMLDLMGVPYTHAGLATSVIAIDKELTKHALVPHGIPMPGGRV
VKSEELYEGDPIARPYVLKPVNEGSSVGVAIVEDTSNCGNPIARDAKGPWQDFDTLLAEP
FIRGRELTTAVIDTPEGPRALGVTELIVADGFYDYENKYTEGRTQHIFPADLPPEVERLC
LEYAMQAHKRLGCKGVSRSDYRYDDERGEDGLFLLETNTQPGMTPLSLVPEQARGCGIEY
PELCEMIVEDALRRAGKLPDG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggctcgatcccctccacgtgcttgtcctgatgggcggctgggcgaatgagcgc
gaggtttcgctcatgtccggcaaaggcgtggccgatgcgctggaaagcgtgggccaccgc
gtcacccggctggatatggaccgcgatgttgcggcgaagatcgccgaggcgaagccggat
gtcgtcttcaacgcgctccatggcgcgccgggagaggacggcacggtgcaaggcatgctc
gacctgatgggcgtgccttacacccatgccggccttgcgacatccgtcatcgccatcgac
aaagagctgaccaagcatgcgctggtgccgcatggcatccccatgccgggcgggcgtgtg
gtaaagagcgaggagctgtacgaaggcgatccgattgcgcggccctatgtgttgaagcca
gtcaatgaagggtccagcgtcggcgtcgccattgtcgaagacaccagcaattgcggcaac
cccatcgcgcgcgatgcaaaggggccgtggcaggatttcgacacgctgctggccgagcca
ttcatccgcgggcgcgaactgaccactgccgtgatcgacacgccggagggcccgcgcgct
ctgggcgtgaccgagctgatcgtggcggacgggttctacgattacgagaacaaatatacc
gaaggccgcacccagcatattttccccgccgaccttccgccagaggtcgagcgattgtgc
ctcgaatatgcgatgcaggcgcacaaacggctcggctgcaaaggcgtctcgcgctccgac
tatcgctacgatgacgagcgcggcgaggatggcctcttcctgctggaaacgaacacccag
ccaggaatgacaccgctcagcctcgtacccgaacaggcgcgcggttgcggcatcgaatat
cccgaactgtgcgagatgatcgtggaggatgcgctgcggcgcgccggaaagcttcctgat
ggctag

DBGET integrated database retrieval system