KEGG   Erythrobacter gangjinensis: BMF35_a0535Help
Entry
BMF35_a0535       CDS       T04581                                 

Definition
(GenBank) DUF81 precursor
  KO
K07090  uncharacterized protein
Organism
egn  Erythrobacter gangjinensis
Brite
KEGG Orthology (KO) [BR:egn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BMF35_a0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: APE27364
UniProt: A0A0G9ML44
LinkDB All DBs
Position
I:complement(544508..545245)
Genome map
AA seq 245 aa AA seqDB search
MLGFSADIILTAIGAAIAAGFVRGLAGFGLSVVLVPVLQLAIAPSAAVLVGIISLFLIGL
TDIGRIRRDADRSAIPITLVALACMPLGLWALVALPPEWARVLIAMVSLGAFVLVVVPLG
KVTLARKPAMALSGFFTGFFGGFAGMPGPGMAPFYLRGRLEPKAARASMMAIFLMVTPLS
AALFIALGIGGREEALLALALFPAVLLGDWFGHRAFGRVTTTQWQVATAMVLGGATLGAL
WKLVS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctcgggttttccgccgacatcatcctcactgcaatcggggctgccattgctgccggc
ttcgtgcgcgggctggcggggttcgggctgtcggtcgtgctggttcccgtactccagctg
gccatcgcaccgagcgctgccgtgctggtcggtatcatctcgctatttcttattggcctc
accgatatcggtcgcatccgccgcgatgcggaccgatccgccatcccgatcacgcttgtc
gcgctcgcctgcatgccgctgggcctgtgggcgctggttgcgctcccgcccgaatgggcg
cgagtcctgatcgccatggtctcgcttggcgcattcgtgctggtcgtggtgccgcttggc
aaggtgacgctggcgcgaaagcccgccatggcgctgtcgggcttctttacagggttcttt
ggcggatttgccggaatgcccgggccgggcatggcgccattctacctgcgcgggcggctg
gagccgaaagccgcgcgtgccagcatgatggcgatctttctgatggtgaccccgctatcg
gccgcgctgttcatagcgctcggcatcggtggccgcgaggaggcgctactggcgctggcg
ctgtttcccgccgtgctgctgggcgactggttcggtcaccgcgctttcggccgtgtcacc
acgacgcagtggcaagtcgccacagcgatggtgctgggcggcgcgacgctgggcgcgctg
tggaagctggtgagctag

DBGET integrated database retrieval system