KEGG   Erythrobacter gangjinensis: BMF35_a0733Help
Entry
BMF35_a0733       CDS       T04581                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
egn  Erythrobacter gangjinensis
Pathway
egn00061  Fatty acid biosynthesis
egn00780  Biotin metabolism
egn01100  Metabolic pathways
egn01130  Biosynthesis of antibiotics
egn01212  Fatty acid metabolism
Module
egn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:egn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BMF35_a0733
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BMF35_a0733
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BMF35_a0733
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:egn01004]
    BMF35_a0733
Enzymes [BR:egn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BMF35_a0733
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BMF35_a0733
Lipid biosynthesis proteins [BR:egn01004]
 Fatty acid synthase
  Component type
   BMF35_a0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: APE27562
UniProt: A0A0G9MLI6
LinkDB All DBs
Position
I:complement(744857..745660)
Genome map
AA seq 267 aa AA seqDB search
MTGLMQGKKGLIMGLANDKSLAWGIAQKLHEQGAEMAFSYPVEALAKRVGPLAERVGSDL
LIQCDVADMDAMDAAFAEIESRWGKLDFLVHAIGFSDKNELRGKYLDTSLENFLNTMNIS
AYSLVAAAKRAAPLMKDGGSILTLTYYGAEKVVPHYNVMGVAKAALETSVQYLANDLGPD
NIRVNAISAGPIKTLAASGIGDFRYILKWNELNAPMRRNVTIDDVGGSGLYFCSDLSSGV
TGEVHHVDAGYHVVGMKQEDAPDIALT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccggactgatgcagggcaagaaggggctgatcatgggcctcgccaacgacaagtcg
ctggcctggggcatcgcgcagaagctgcatgagcagggcgccgaaatggcgttctcctac
ccggtcgaggcgctggccaagcgcgtcggcccgctggcagagcgcgtgggcagcgatctc
ctgatccagtgcgatgtggccgatatggatgcgatggacgccgcctttgccgaaatcgag
agccgctggggcaagctcgatttcctcgtccatgccatcggcttttccgacaagaacgag
ctgcgcggcaagtatctcgataccagcctcgagaatttcctgaacacgatgaacatctcg
gcctattcgctggtcgccgccgccaagcgcgccgcgccgctgatgaaagatggcggcagc
atcctcacgctcacctattacggcgccgaaaaggtcgtgccgcattacaatgtgatgggg
gtggccaaggcggcgctggaaacgagcgtgcaatatctcgccaacgatcttgggccggac
aacatccgtgtgaacgcgatcagcgccgggccgatcaagacgctggctgcgagcggcatc
ggcgatttccgctacatccttaaatggaacgagctgaacgcgcccatgcgccgcaatgtc
actatcgacgatgtgggcggatcgggcctctatttttgctccgacctgtcatccggcgtg
acgggcgaggtccatcatgtagacgccggctatcacgtggtcggcatgaagcaggaagat
gcgcccgatatcgcgctgacctga

DBGET integrated database retrieval system